Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.46
PubTator Score 8.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
active Crohn's disease 1.790 4.5e-03
active ulcerative colitis 1.941 8.3e-03
adult high grade glioma -1.900 2.4e-06
atypical teratoid / rhabdoid tumor -1.700 9.3e-03
cystic fibrosis 1.280 1.2e-04
diabetes mellitus -1.100 2.9e-02
ependymoma -1.700 1.3e-06
gastric carcinoma -1.200 2.5e-02
glioblastoma -1.600 5.9e-06
group 3 medulloblastoma -1.100 4.8e-02
hepatocellular carcinoma 1.200 4.8e-05
intraductal papillary-mucinous adenoma (... -2.000 4.7e-04
intraductal papillary-mucinous carcinoma... -1.400 4.9e-02
intraductal papillary-mucinous neoplasm ... -1.800 1.6e-02
lung carcinoma 1.100 1.1e-12
malignant mesothelioma -1.600 9.6e-07
medulloblastoma, large-cell -1.400 8.4e-03
osteosarcoma -1.747 1.1e-03
ovarian cancer -2.600 3.0e-09
pituitary cancer 1.100 1.3e-02
psoriasis -1.200 2.1e-06
subependymal giant cell astrocytoma -2.111 2.5e-02

Gene RIF (4)

AA Sequence

MLLKEYRICMPLTVDEYKIGQLYMISKHSHEQSDRGEGVEVVQNEPFEDPHHGNGQFTEKRVYLNSKLPS      1 - 70
WARAVVPKIFYVTEKAWNYYPYTITEYTCSFLPKFSIHIETKYEDNKGSNDTIFDNEAKDVEREVCFIDI     71 - 140
ACDEIPERYYKESEDPKHFKSEKTGRGQLREGWRDSHQPIMCSYKLVTVKFEVWGLQTRVEQFVHKVVRD    141 - 210
ILLIGHRQAFAWVDEWYDMTMDEVREFERATQEATNKKIGIFPPAISISSIPLLPSSVRSAPSSAPSTPL    211 - 280
STDAPEFLSVPKDRPRKKSAPETLTLPDPEKKATLNLPGMHSSDKPCRPKSE                      281 - 332
//

Text Mined References (19)

PMID Year Title