Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.39
PubTator Score 8.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
hepatocellular carcinoma 1.200 4.8e-05
malignant mesothelioma -1.600 9.6e-07
osteosarcoma -1.747 1.1e-03
posterior fossa group A ependymoma -2.000 2.4e-07
glioblastoma -2.200 6.3e-04
cystic fibrosis 1.280 1.2e-04
atypical teratoid / rhabdoid tumor -1.700 9.3e-03
medulloblastoma, large-cell -2.100 9.7e-04
intraductal papillary-mucinous adenoma (... -2.000 4.7e-04
intraductal papillary-mucinous carcinoma... -1.400 4.9e-02
intraductal papillary-mucinous neoplasm ... -1.800 1.6e-02
active Crohn's disease 1.790 4.5e-03
ulcerative colitis 2.300 2.7e-10
diabetes mellitus -1.100 2.9e-02
pediatric high grade glioma -1.900 1.1e-04
group 4 medulloblastoma -1.600 1.1e-05
subependymal giant cell astrocytoma -2.111 2.5e-02
psoriasis -1.200 2.1e-06
lung carcinoma 1.100 1.1e-12
gastric carcinoma -1.200 2.5e-02
ovarian cancer -3.500 3.9e-16
pituitary cancer 1.100 1.3e-02

Synonym

Accession Q9UKF7 A8K473 J3QR20 Q96I07
Symbols RDGBB
RDGBB1
MRDGBbeta
RDGB-BETA
M-RDGB-beta

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (4)

PMID Text
26977884 PITPNC1-mediated vesicular release.
22865700 The most significantly associated SNPs to type 2 diabetes mellitus in this study are expression SNPs to the lymphocyte antigen 75 gene, the ubiquitin-specific peptidase 36 gene, and the phosphatidylinositol transfer protein, cytoplasmic 1 gene.
22822086 Phosphatidylinositol transfer protein, cytoplasmic 1 (PITPNC1) binds and transfers phosphatidic acid
21728994 The phosphatidylinositol transfer protein RdgBbeta binds 14-3-3 via its unstructured C-terminus, whereas its lipid-binding domain interacts with the integral membrane protein ATRAP (angiotensin II type I receptor-associated protein).

AA Sequence

MLLKEYRICMPLTVDEYKIGQLYMISKHSHEQSDRGEGVEVVQNEPFEDPHHGNGQFTEKRVYLNSKLPS      1 - 70
WARAVVPKIFYVTEKAWNYYPYTITEYTCSFLPKFSIHIETKYEDNKGSNDTIFDNEAKDVEREVCFIDI     71 - 140
ACDEIPERYYKESEDPKHFKSEKTGRGQLREGWRDSHQPIMCSYKLVTVKFEVWGLQTRVEQFVHKVVRD    141 - 210
ILLIGHRQAFAWVDEWYDMTMDEVREFERATQEATNKKIGIFPPAISISSIPLLPSSVRSAPSSAPSTPL    211 - 280
STDAPEFLSVPKDRPRKKSAPETLTLPDPEKKATLNLPGMHSSDKPCRPKSE                      281 - 332
//

Text Mined References (19)

PMID Year Title
26977884 2016 PITPNC1 Recruits RAB1B to the Golgi Network to Drive Malignant Secretion.
25416956 2014 A proteome-scale map of the human interactome network.
24503447 2014 Genome-wide association study to characterize serum bilirubin elevations in patients with HCV treated with GS-9256, an HCV NS3 serine protease inhibitor.
23932459 2014 Genome-wide association study of lung function phenotypes in a founder population.
22865700 2012 Integrating genetic association, genetics of gene expression, and single nucleotide polymorphism set analysis to identify susceptibility Loci for type 2 diabetes mellitus.
22822086 2012 Phosphatidylinositol transfer protein, cytoplasmic 1 (PITPNC1) binds and transfers phosphatidic acid.
21728994 2011 The phosphatidylinositol transfer protein RdgB? binds 14-3-3 via its unstructured C-terminus, whereas its lipid-binding domain interacts with the integral membrane protein ATRAP (angiotensin II type I receptor-associated protein).
19060904 2009 An empirical framework for binary interactome mapping.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17543578 2007 RdgB proteins: functions in lipid homeostasis and signal transduction.
17090528 2007 Substrate specificity of RdgB protein, a deoxyribonucleoside triphosphate pyrophosphohydrolase.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12401207 2002 Current thoughts on the phosphatidylinositol transfer protein family.
10531358 1999 Cloning and characterization of a novel human phosphatidylinositol transfer protein, rdgBbeta.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.