Property Summary

NCBI Gene PubMed Count 10
PubMed Score 133.45
PubTator Score 27.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
nephrosclerosis -1.777 1.8e-02
glioblastoma 1.500 1.2e-02
posterior fossa group B ependymoma 1.800 1.0e-07
atypical teratoid / rhabdoid tumor 2.300 3.4e-05
adult high grade glioma 1.700 5.7e-04
sonic hedgehog group medulloblastoma -1.200 9.6e-04
ovarian cancer 1.800 5.0e-06
pituitary cancer 1.300 2.2e-03

Synonym

Accession Q9P0Z9 B3KNH0 Q96H28 Q9C070 PSO
Symbols LPIPOX

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (6)

Gene RIF (1)

PMID Text
20634891 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAQKDLWDAIVIGAGIQGCFTAYHLAKHRKRILLLEQFFLPHSRGSSHGQSRIIRKAYLEDFYTRMMHE      1 - 70
CYQIWAQLEHEAGTQLHRQTGLLLLGMKENQELKTIQANLSRQRVEHQCLSSEELKQRFPNIRLPRGEVG     71 - 140
LLDNSGGVIYAYKALRALQDAIRQLGGIVRDGEKVVEINPGLLVTVKTTSRSYQAKSLVITAGPWTNQLL    141 - 210
RPLGIEMPLQTLRINVCYWREMVPGSYGVSQAFPCFLWLGLCPHHIYGLPTGEYPGLMKVSYHHGNHADP    211 - 280
EERDCPTARTDIGDVQILSSFVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHG    281 - 350
FKLAPVVGKILYELSMKLTPSYDLAPFRISRFPSLGKAHL                                  351 - 390
//

Text Mined References (12)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11330064 2000 The human L-pipecolic acid oxidase is similar to bacterial monomeric sarcosine oxidases rather than D-amino acid oxidases.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
10772957 2000 Molecular cloning and expression of human L-pipecolate oxidase.
10642506 2000 L-Pipecolic acid oxidase, a human enzyme essential for the degradation of L-pipecolic acid, is most similar to the monomeric sarcosine oxidases.