Property Summary

NCBI Gene PubMed Count 10
PubMed Score 160.43
PubTator Score 27.78

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma 1.700 5.7e-04
atypical teratoid / rhabdoid tumor 2.300 3.4e-05
ependymoma 1.100 2.3e-04
glioblastoma 1.200 3.1e-02
nephrosclerosis -1.777 1.8e-02
ovarian cancer 1.800 5.0e-06
pituitary cancer 1.300 2.2e-03
sonic hedgehog group medulloblastoma -1.200 9.6e-04

Protein-protein Interaction (6)

Gene RIF (1)

AA Sequence

MAAQKDLWDAIVIGAGIQGCFTAYHLAKHRKRILLLEQFFLPHSRGSSHGQSRIIRKAYLEDFYTRMMHE      1 - 70
CYQIWAQLEHEAGTQLHRQTGLLLLGMKENQELKTIQANLSRQRVEHQCLSSEELKQRFPNIRLPRGEVG     71 - 140
LLDNSGGVIYAYKALRALQDAIRQLGGIVRDGEKVVEINPGLLVTVKTTSRSYQAKSLVITAGPWTNQLL    141 - 210
RPLGIEMPLQTLRINVCYWREMVPGSYGVSQAFPCFLWLGLCPHHIYGLPTGEYPGLMKVSYHHGNHADP    211 - 280
EERDCPTARTDIGDVQILSSFVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHG    281 - 350
FKLAPVVGKILYELSMKLTPSYDLAPFRISRFPSLGKAHL                                  351 - 390
//

Text Mined References (12)

PMID Year Title