Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.75
PubTator Score 2.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.5

Expression

Gene RIF (2)

AA Sequence

MAAPSPGPREVLAPSPEAGCRAVTSSRRGLLWRLRDKQSRLGLFEISPGHELHGMTCMMQAGLWAATQVS      1 - 70
MDHPPTGPPSRDDFSEVLTQVHEGFELGTLAGPAFAWLRRSLGLAEEDYQAALGPGGPYLQFLSTSKSKA     71 - 140
SFFLSHDQRFFLKTQGRREVQALLAHLPRYVQHLQRHPHSLLARLLGVHSLRVDRGKKTYFIVMQSVFYP    141 - 210
AGRISERYDIKGCEVSRWVDPAPEGSPLVLVLKDLNFQGKTINLGPQRSWFLRQMELDTTFLRELNVLDY    211 - 280
SLLIAFQRLHEDERGPGSSLIFRTARSVQGAQSPEESRAQNRRLLPDAPNALHILDGPEQRYFLGVVDLA    281 - 350
TVYGLRKRLEHLWKTLRYPGRTFSTVSPARYARRLCQWVEAHTE                              351 - 394
//

Text Mined References (6)

PMID Year Title