Property Summary

NCBI Gene PubMed Count 38
PubMed Score 15.56
PubTator Score 13.81

Knowledge Summary

Patent (635)

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -2.100 4.6e-05
osteosarcoma -1.118 7.3e-04
posterior fossa group B ependymoma -1.700 2.7e-12
glioblastoma -1.100 1.2e-07
group 3 medulloblastoma -1.400 1.7e-03
atypical teratoid/rhabdoid tumor -1.200 6.8e-07

Gene RIF (28)

PMID Text
26916822 PIPKIgamma and INPP5E localize to the centrosome and coordinate the initiation of ciliogenesis.
26149501 results suggested that Akt-mediated PIP5Kgamma90 S555 phosphorylation is a novel regulatory point for talin binding to control PIP2 level at the FAs, thereby modulating FA dynamics and cell motility.
26070568 Loss of PIPKIgamma or its focal adhesion-targeting variant, PIPKIgammai2, impaired PI3K/Akt activation upon stimulation with growth factors or extracellular matrix proteins in different tumor cells.
24434581 PIPKIgamma binds to the cryptic polo-box domain of PLK4 and reduces the kinase activity of PLK4.
24151076 This study uncovers a novel mechanism where a phosphoinositide-synthesizing enzyme, PIPKIgammai2, functions with the proto-oncogene Src, to regulate oncogenic signaling
22049025 PIPKIgamma and phosphatidyl inositol phosphate pools at nascent E-cadherin contacts cue Exo70 targeting and orient the tethering of exocyst-associated E-cadherin
21931851 PIPKIgamma positively regulates focal adhesion dynamics and cancer invasion, most probably through PIP-mediated vinculin activation.
21303971 A novel mechanism in which PIPKIgamma expression and catalytic activity enhance beta-catenin nuclear translocation and expression of its target genes to promote tumorigenic phenotypes.
21216957 EZH2 regulates neuronal differentiation of mesenchymal stem cells through PIP5K1C-dependent calcium signaling.
20668706 SIRT1 deacetylated two specific lysine residues (K265/K268) in PIP5Kgamma and enhanced PIP5Kgamma enzyme activity.
20435073 Data show that glycation end products (AGE) increase PIP2 production, arachidonic acid release and reactive oxygen species via cytosolic phospholipase A2 activation, and inhibit Na+ K+ ATPase surface expression via PIP5Kgamma.
20074374 Type I gamma phosphatidylinositol phosphate kinase modulates invasion and proliferation and its expression correlates with poor prognosis in breast cancer.
19903820 multiple interactions between PIPKI gamma-p90 and AP-2 lead to spatiotemporally controlled PI(4,5)P(2) synthesis during clathrin-mediated synaptic vesicle endocytosis
19548880 Data have identified two novel C-terminal splice variants of PIPKIgamma that are expressed in multiple tissue types, display PIPK activity in vitro abd have distinct subcellular targeting.
18187620 Knockdown of phosphatidylinositol-4-phosphate 5-kinase, type I, gamma (PIP5K1C) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18073347 Type I phosphatidylinositol-4-phosphate-5-kinase (PI5KI) alpha and gamma isoforms were identified as the enzymes responsible for PIP2 synthesis in natural killer cells.
17928408 identify a previously unknown function for PIPKIgamma661 as a novel component of the backness signal that regulates rear retraction during chemotaxis
17701898 A single homozygous substitution of aspartic acid with asparagine at amino acid 253 in PIP5K1C causes lethal contractural syndrome type 3>
17635937 PIP5K1C is required for EGF-stimulated diectional cell migration.
17261850 results reveal a novel mechanism where PIPKIgamma serves as a scaffold, linking E-cadherin to adaptor complexes and the trafficking machinery, and a regulator of trafficking events via the spatial generation of phosphatidylinositol-4,5-bisphosphate
17229424 Localization of ezrin in adherens junctions is regulated by Rac in a manner involving PIPK.
16880396 a positive feedback loop consisting of endocytic cargo proteins, AP-2mu, and PIPK type I which may provide a specific pool of PI(4,5)P(2) dedicated to clathrin/AP-2-dependent receptor internalization
16707488 PIPKIgamma661 enzyme is involved in the AP2-mediated endocytosis of transferrin.
15611330 The short splice variant of type I phosphatidylinositol 4-phosphate 5-kinase gamma (PIP5KIgamma87) as the major contributor of the PIP(2) pool that supports G protein-coupled receptor (GPCR)-mediated IP(3) generation.
12422220 we show that the type I phosphatidylinositol phosphate kinase isoform-gamma 661 (PIPKI gamma 661), an enzyme that makes PtdIns(4,5)P(2), is targeted to focal adhesions by an association with talin
12422219 we show that the predominant brain splice variant of PtdInsPKI gamma (PtdInsPKI gamma-90) binds, by means of a short carboxy-terminal peptide, to the FERM domain of talin, and is strongly activated by this interaction
9628581 This publication discusses the initial identification of human phosphatidylinositol-4-phosphate 5-kinase type-1 gamma (AB011161, KIAA0589).
9535851 This publication discusses cloning of mouse phosphatidylinositol-4-phosphate 5-kinase type-1 gamma.

AA Sequence

MELEVPDEAESAEAGAVPSEAAWAAESGAAAGLAQKKAAPTEVLSMTAQPGPGHGKKLGHRGVDASGETT      1 - 70
YKKTTSSTLKGAIQLGIGYTVGHLSSKPERDVLMQDFYVVESIFFPSEGSNLTPAHHFQDFRFKTYAPVA     71 - 140
FRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSLFYVTSDDEFIIKTVMHKEAEFLQKLLPGYYMNLN    141 - 210
QNPRTLLPKFYGLYCVQSGGKNIRVVVMNNILPRVVKMHLKFDLKGSTYKRRASKKEKEKSFPTYKDLDF    211 - 280
MQDMPEGLLLDADTFSALVKTLQRDCLVLESFKIMDYSLLLGVHNIDQHERERQAQGAQSTSDEKRPVGQ    281 - 350
KALYSTAMESIQGGAARGEAIESDDTMGGIPAVNGRGERLLLHIGIIDILQSYRFIKKLEHTWKALVHDG    351 - 420
DTVSVHRPSFYAERFFKFMSNTVFRKNSSLKSSPSKKGRGGALLAVKPLGPTAAFSASQIPSEREEAQYD    421 - 490
LRGARSYPTLEDEGRPDLLPCTPPSFEEATTASIATTLSSTSLSIPERSPSETSEQPRYRRRTQSSGQDG    491 - 560
RPQEEPPAEEDLQQITVQVEPACSVEIVVPKEEDAGVEASPAGASAAVEVETASQASDEEGAPASQASDE    561 - 630
EDAPATDIYFPTDERSWVYSPLHYSAQAPPASDGESDT                                    631 - 668
//

Text Mined References (40)

PMID Year Title
27365365 2016 Diverse alternative back-splicing and alternative splicing landscape of circular RNAs.
26916822 2016 Phosphatidylinositol phosphate kinase PIPKI? and phosphatase INPP5E coordinate initiation of ciliogenesis.
26149501 2015 Phosphorylation of phosphatidylinositol 4-phosphate 5-kinase ? by Akt regulates its interaction with talin and focal adhesion dynamics.
26070568 2015 Phosphatidylinositol Phosphate 5-Kinase I? and Phosphoinositide 3-Kinase/Akt Signaling Couple to Promote Oncogenic Growth.
24434581 2014 PIPKI? targets to the centrosome and restrains centriole duplication.
24151076 2013 Phosphatidylinositol phosphate 5-kinase I?i2 in association with Src controls anchorage-independent growth of tumor cells.
23982733 2013 IQGAP1 is a novel phosphatidylinositol 4,5 bisphosphate effector in regulation of directional cell migration.
22049025 2012 An association between type I? PI4P 5-kinase and Exo70 directs E-cadherin clustering and epithelial polarization.
21931851 2011 PIPKI? regulates focal adhesion dynamics and colon cancer cell invasion.
21303971 2011 PIPKI? regulates ?-catenin transcriptional activity downstream of growth factor receptor signaling.
21216957 2011 EZH2 regulates neuronal differentiation of mesenchymal stem cells through PIP5K1C-dependent calcium signaling.
20668706 2010 SIRT1 Regulates Thyroid-Stimulating Hormone Release by Enhancing PIP5Kgamma Activity through Deacetylation of Specific Lysine Residues in Mammals.
20435073 2010 Advanced glycation end products inhibit Na+ K+ ATPase in proximal tubule epithelial cells: role of cytosolic phospholipase A2alpha and phosphatidylinositol 4-phosphate 5-kinase gamma.
20074374 2010 Type I gamma phosphatidylinositol phosphate kinase modulates invasion and proliferation and its expression correlates with poor prognosis in breast cancer.
19903820 2010 Molecular basis for association of PIPKI gamma-p90 with clathrin adaptor AP-2.
19889969 2009 PIP5K-driven PtdIns(4,5)P2 synthesis: regulation and cellular functions.
19548880 2009 Two novel phosphatidylinositol-4-phosphate 5-kinase type Igamma splice variants expressed in human cells display distinctive cellular targeting.
18073347 2008 PI5KI-dependent signals are critical regulators of the cytolytic secretory pathway.
17928408 2007 Type Igamma PIP kinase is a novel uropod component that regulates rear retraction during neutrophil chemotaxis.
17701898 2007 Lethal contractural syndrome type 3 (LCCS3) is caused by a mutation in PIP5K1C, which encodes PIPKI gamma of the phophatidylinsitol pathway.
17635937 2007 Type I gamma phosphatidylinositol phosphate kinase is required for EGF-stimulated directional cell migration.
17261850 2007 Type I gamma phosphatidylinositol phosphate kinase modulates adherens junction and E-cadherin trafficking via a direct interaction with mu 1B adaptin.
17229424 2007 Regulation of ezrin localization by Rac1 and PIPK in human epithelial cells.
16880396 2006 Stimulation of phosphatidylinositol kinase type I-mediated phosphatidylinositol (4,5)-bisphosphate synthesis by AP-2mu-cargo complexes.
16707488 2006 Type Igamma661 phosphatidylinositol phosphate kinase directly interacts with AP2 and regulates endocytosis.
15738269 2005 Regulation of the interaction between PIPKI gamma and talin by proline-directed protein kinases.
15611330 2004 Critical role of PIP5KI{gamma}87 in InsP3-mediated Ca(2+) signaling.
15057824 2004 The DNA sequence and biology of human chromosome 19.
15046600 2004 Btk-dependent regulation of phosphoinositide synthesis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14614850 2003 Branches of the B cell antigen receptor pathway are directed by protein conduits Bam32 and Carma1.
12847086 2003 ARF6 stimulates clathrin/AP-2 recruitment to synaptic membranes by activating phosphatidylinositol phosphate kinase type Igamma.
12682053 2003 Membrane ruffling requires coordination between type Ialpha phosphatidylinositol phosphate kinase and Rac signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12422220 2002 Type I gamma phosphatidylinositol phosphate kinase targets and regulates focal adhesions.
12422219 2002 Recruitment and regulation of phosphatidylinositol phosphate kinase type 1 gamma by the FERM domain of talin.
11604140 2001 PIP kinase Igamma is the major PI(4,5)P(2) synthesizing enzyme at the synapse.
10827173 2000 Interactions of the low density lipoprotein receptor gene family with cytosolic adaptor and scaffold proteins suggest diverse biological functions in cellular communication and signal transduction.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
9535851 1998 Type I phosphatidylinositol-4-phosphate 5-kinases. Cloning of the third isoform and deletion/substitution analysis of members of this novel lipid kinase family.