Property Summary

NCBI Gene PubMed Count 23
PubMed Score 11.19
PubTator Score 10.96

Knowledge Summary

Patent (2,309)

Expression

  Differential Expression (30)

Disease log2 FC p
astrocytic glioma -2.800 1.7e-03
posterior fossa group A ependymoma -3.500 5.7e-11
oligodendroglioma -2.600 4.1e-03
Barrett's esophagus 2.500 2.9e-02
esophageal adenocarcinoma 2.700 1.8e-02
glioblastoma -3.700 3.7e-09
osteosarcoma -3.289 1.1e-04
medulloblastoma -4.800 8.1e-09
periodontitis 1.400 1.6e-22
atypical teratoid / rhabdoid tumor -3.500 7.3e-05
medulloblastoma, large-cell -4.800 5.5e-08
primitive neuroectodermal tumor -3.500 1.7e-04
ulcerative colitis -1.300 3.9e-04
Amyotrophic Lateral Sclerosis 1.563 1.1e-07
acute quadriplegic myopathy 1.062 7.5e-05
tuberculosis 1.400 7.7e-07
non-small cell lung cancer -2.894 1.0e-25
intraductal papillary-mucinous adenoma (... 1.800 8.3e-05
intraductal papillary-mucinous carcinoma... 1.900 6.5e-05
intraductal papillary-mucinous neoplasm ... 2.000 1.8e-03
lung cancer -2.300 1.9e-04
interstitial cystitis 1.800 5.3e-04
lung adenocarcinoma -2.000 7.2e-17
pediatric high grade glioma -2.900 1.6e-07
pilocytic astrocytoma -3.000 9.2e-08
subependymal giant cell astrocytoma -1.643 2.6e-02
lung carcinoma -2.000 3.3e-23
Breast cancer -2.000 2.7e-06
ovarian cancer -3.200 5.7e-15
pituitary cancer -3.200 3.1e-07

Gene RIF (9)

PMID Text
25713054 Data indicate that type I phosphatidylinositol 4-phosphate 5-kinase PIP5KIbeta mutants whose dimerization was impaired showed a severe decrease in PI(4,5)P2 production and plasma membrane delocalization.
23552101 Knockdown of PIP5K1B in fibroblasts reproduced abnormal actin cytoskeleton remodeling evidenced in Friedreich's ataxia patient cells.
20624912 Results identify PIPKIbeta as a novel regulator of focal adhesion disassembly and suggest that PIPKIbeta spatially regulates beta1 integrin endocytosis at adhesion sites to control cell migration.
20442317 Results identify an isoform-specific PDZ-binding motif in PIP5KIbeta, which confers specificity for PIP5KIbeta signaling at the uropod during leukocyte chemotaxis.
20383146 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19850283 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19553680 Syk-dependent phosphorylation of PIP5K1B is the dominant modification responsible for the decrease in cellular phosphatidylinositol 4,5-bisphosphate.
18158329 findings show that the human type I phosphatidylinositol 4-phosphate 5-kinase isoform beta (PIPKIbeta) has a role in organizing signaling at the cell rear

AA Sequence

MSSAAENGEAAPGKQNEEKTYKKTASSAIKGAIQLGIGYTVGNLTSKPERDVLMQDFYVVESVFLPSEGS      1 - 70
NLTPAHHYPDFRFKTYAPLAFRYFRELFGIKPDDYLYSICSEPLIELSNPGASGSLFFVTSDDEFIIKTV     71 - 140
QHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCMQSGGINIRIVVMNNVLPRSMRMHFTYDLKGSTYK    141 - 210
RRASRKEREKSNPTFKDLDFLQDMHEGLYFDTETYNALMKTLQRDCRVLESFKIMDYSLLLGIHFLDHSL    211 - 280
KEKEEETPQNVPDAKRTGMQKVLYSTAMESIQGPGKSGDGIITENPDTMGGIPAKSHRGEKLLLFMGIID    281 - 350
ILQSYRLMKKLEHSWKALVYDGDTVSVHRPSFYADRFLKFMNSRVFKKIQALKASPSKKRCNSIAALKAT    351 - 420
SQEIVSSISQEWKDEKRDLLTEGQSFSSLDEEALGSRHRPDLVPSTPSLFEAASLATTISSSSLYVNEHY    421 - 490
PHDRPTLYSNSKGLPSSSTFTLEEGTIYLTAEPNTLEVQDDNASVLDVYL                        491 - 540
//

Text Mined References (26)

PMID Year Title
25713054 2015 Type I phosphatidylinositol 4-phosphate 5-kinase homo- and heterodimerization determines its membrane localization and activity.
23552101 2013 Cis-silencing of PIP5K1B evidenced in Friedreich's ataxia patient cells results in cytoskeleton anomalies.
23470693 2013 Genome-wide association studies of pit-and-fissure- and smooth-surface caries in permanent dentition.
23192594 2013 Gene-environment interactions and obesity traits among postmenopausal African-American and Hispanic women in the Women's Health Initiative SHARe Study.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20624912 2010 Type I phosphatidylinositol phosphate kinase beta regulates focal adhesion disassembly by promoting beta1 integrin endocytosis.
20442317 2010 An isoform-specific PDZ-binding motif targets type I PIP5 kinase beta to the uropod and controls polarization of neutrophil-like HL60 cells.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19850283 2010 Identification of novel candidate genes for treatment response to risperidone and susceptibility for schizophrenia: integrated analysis among pharmacogenomics, mouse expression, and genetic case-control association approaches.
19553680 2009 Oxidative stress decreases phosphatidylinositol 4,5-bisphosphate levels by deactivating phosphatidylinositol- 4-phosphate 5-kinase beta in a Syk-dependent manner.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18158329 2007 Type I phosphatidylinositol 4-phosphate 5-kinase controls neutrophil polarity and directional movement.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
15046600 2004 Btk-dependent regulation of phosphoinositide synthesis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701839 2004 Identification and characterization of a phosphoinositide phosphate kinase homolog.
14614850 2003 Branches of the B cell antigen receptor pathway are directed by protein conduits Bam32 and Carma1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9177790 1997 Exon-intron structure of a 2.7-kb transcript of the STM7 gene with phosphatidylinositol-4-phosphate 5-kinase activity.
8955136 1996 Type I phosphatidylinositol-4-phosphate 5-kinases are distinct members of this novel lipid kinase family.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8841185 1996 The Friedreich's ataxia gene encodes a novel phosphatidylinositol-4- phosphate 5-kinase.
7581382 1995 Friedreich's ataxia: a defect in signal transduction?