Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.41
PubTator Score 31.31

Knowledge Summary

Patent (989)

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.800 3.1e-03
ependymoma -1.800 1.1e-02
oligodendroglioma -1.500 1.9e-02
psoriasis -2.500 3.7e-05
osteosarcoma -1.281 9.4e-03
atypical teratoid / rhabdoid tumor -1.500 2.8e-07
glioblastoma -1.300 5.3e-05
medulloblastoma -1.400 6.9e-05
medulloblastoma, large-cell -1.900 3.9e-05
primitive neuroectodermal tumor -1.100 4.3e-03
intraductal papillary-mucinous neoplasm ... 1.400 3.5e-04
invasive ductal carcinoma 1.100 3.0e-03
pituitary cancer 1.200 1.8e-04

Gene RIF (3)

PMID Text
20439292 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19644859 Observational study of gene-disease association. (HuGE Navigator)
18794853 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MASSSVPPATVSAATAGPGPGFGFASKTKKKHFVQQKVKVFRAADPLVGVFLWGVAHSINELSQVPPPVM      1 - 70
LLPDDFKASSKIKVNNHLFHRENLPSHFKFKEYCPQVFRNLRDRFGIDDQDYLVSLTRNPPSESEGSDGR     71 - 140
FLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNTLLPQFLGMYRVSVDNEDSYMLVMRNMFSHR    141 - 210
LPVHRKYDLKGSLVSREASDKEKVKELPTLKDMDFLNKNQKVYIGEEEKKIFLEKLKRDVEFLVQLKIMD    211 - 280
YSLLLGIHDIIRGSEPEEEAPVREDESEVDGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESF    281 - 350
IDVYAIRSAEGAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGAEISTVHPEQYAKRFLDFITNIF    351 - 420
A//

Text Mined References (21)

PMID Year Title
25578879 2015 PI(5)P regulates autophagosome biogenesis.
25495341 2015 The function of phosphatidylinositol 5-phosphate 4-kinase ? (PI5P4K?) explored using a specific inhibitor that targets the PI5P-binding site.
23758345 2013 Evolutionarily conserved structural changes in phosphatidylinositol 5-phosphate 4-kinase (PI5P4K) isoforms are responsible for differences in enzyme activity and localization.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20439292 2010 Genetic variants in the prediction of rheumatoid arthritis.
19644859 2009 Association of a single-nucleotide polymorphism in CD40 with the rate of joint destruction in rheumatoid arthritis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18794853 2008 Common variants at CD40 and other loci confer risk of rheumatoid arthritis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
18255255 2008 A protein-protein interaction network of transcription factors acting during liver cell proliferation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15046600 2004 Btk-dependent regulation of phosphoinositide synthesis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9367159 1997 A new pathway for synthesis of phosphatidylinositol-4,5-bisphosphate.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.