Property Summary

NCBI Gene PubMed Count 46
PubMed Score 53.39
PubTator Score 42.11

Knowledge Summary

Patent (1,480)

Expression

  Differential Expression (14)

Disease log2 FC p
osteosarcoma -2.579 9.5e-05
posterior fossa group B ependymoma -1.900 8.4e-10
glioblastoma -1.100 1.1e-03
atypical teratoid/rhabdoid tumor -2.200 4.1e-10
medulloblastoma, large-cell -1.100 2.9e-03
primitive neuroectodermal tumor -1.200 3.9e-04
diabetes mellitus -1.200 3.7e-02
pediatric high grade glioma -1.300 3.8e-04
sonic hedgehog group medulloblastoma -1.400 1.1e-03
primary Sjogren syndrome 1.500 1.5e-02
lung carcinoma -1.400 1.1e-25
gastric carcinoma 1.100 2.3e-02
ulcerative colitis 1.200 1.1e-04
ovarian cancer -1.600 1.3e-08

Gene RIF (36)

PMID Text
25548108 PIP5K2A is possibly involved in a mechanism protecting against tardive dyskinesia-inducing neurotoxicity.
25025909 The diplotype ATTGCT/ATTGCT of the PIP4K2A gene confers approximately three-times higher incomplete responsiveness towards antipsychotics in severely ill patients.
24788727 We also showed that PIPKIIalpha silencing can induce alpha and gamma globin expression and decrease cell proliferation in K562 cells.
24681948 PIP4K2A to be essential for the clonogenic and leukemia-initiating potential of human AML cells, and for the clonogenic potential of murine MLL-AF9 AML cells.
24209622 Knocking down PI5P4Kalpha and beta in a breast cancer cell line bearing an amplification of the gene encoding PI5P4K beta and deficient for p53 impaired growth on plastic and in xenografts.
24086693 Overexpression of type 2A PI(4)P5-kinase (PIP5K 2A) significantly reduced tamoxifen inhibition of Kv7.2/Kv7.3 and Kv7.2 R463Q channels.
24081551 The data suggest that PI5P4Ka N251S does not significantly differ in activity from the wild-type enzyme, throwing a new light on its association with schizophrenia.
23996088 Variation at 10p12.2 (PIP4K2A) and 10p14 (GATA3) influences risk of acute lymphoblastic anemia and tumor subtype. (Meta-analysis)
23739505 PIP5K2A variant influences susceptibility to schizophrenia in the Russian population of Siberia. Authors studied 355 patients with schizophrenic disorders from the Russian population of Siberia.
21377334 The present study demonstrated that expression of PIP4K2A mRNA is significantly increased in LCL derived from patients with schizophrenia
21124964 Studies indicate that the gene PIP5K2A was significantly elevated in stroma cells in distant metastasis group, compared to stroma in no distant metastasis group.
21041608 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20583997 PIP4Kbeta interacts with and modulates nuclear localization of the PIP4Kalpha.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19937977 A homogeneous sample of 280 schizophrenia patients and 230 healthy controls of Hungarian, Caucasian descent were genotyped for polymorphisms in schizophrenia candidate genes NRG1, DTNBP1, RGS4, G72/G30, and PIP5K2A.
19937977 Observational study of gene-disease association. (HuGE Navigator)
19656170 PIP4KIIA may be one of the factors related to the regulation of the beta-globin gene expression and the different levels of Hb H in alpha-thalassemic patients
19644675 PIP5K2A is a novel signaling element in the regulation of EAAT3 activity
19475563 study supports a minor role for PIP4K2A in schizophrenia etiology in the Irish population
19475563 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19328558 Observational study of gene-disease association. (HuGE Navigator)
18545987 We find that wild-type PIP5K2A but not the schizophrenia-associated mutant (N251S)-PIP5K2A activates heteromeric KCNQ2/KCNQ3 and KCNQ3/KCNQ5, the molecular correlate of neuronal M channels.
18364242 unlike PtdIns5P production enhanced by cell stress, we show that this pool of PtdIns5P is specifically regulated by the inositol lipid kinase PIP4K2a
18314871 rs11013052 was significantly associated with schizophrenia in this Indonesian family sample
18314871 Observational study of gene-disease association. (HuGE Navigator)
17555944 Observational study of gene-disease association. (HuGE Navigator)
17555944 PIP5K2A gene is implicated in schizophrenia in Chinese population
17410640 Observational study of gene-disease association. (HuGE Navigator)
17410640 The strongest evidence for schizophrenia association was found for the A-allele of SNP rs10828317 in the PIP5K2A gene, which was associated with both clinical subtypes. This SNP leads to a change in protein composition.
16823801 Observational study of gene-disease association. (HuGE Navigator)
16801950 Observational study of gene-disease association. (HuGE Navigator)
16801950 Single nucleotide polymorphism is associated with schizophfenia.
16385451 Observational study of gene-disease association. (HuGE Navigator)
16094259 Observational study of gene-disease association. (HuGE Navigator)
14582145 Observational study of gene-disease association. (HuGE Navigator)
12509423 translocation by protein kinase C is required for platelet alpha-granule secretion

AA Sequence

MATPGNLGSSVLASKTKTKKKHFVAQKVKLFRASDPLLSVLMWGVNHSINELSHVQIPVMLMPDDFKAYS      1 - 70
KIKVDNHLFNKENMPSHFKFKEYCPMVFRNLRERFGIDDQDFQNSLTRSAPLPNDSQARSGARFHTSYDK     71 - 140
RYIIKTITSEDVAEMHNILKKYHQYIVECHGITLLPQFLGMYRLNVDGVEIYVIVTRNVFSHRLSVYRKY    141 - 210
DLKGSTVAREASDKEKAKELPTLKDNDFINEGQKIYIDDNNKKVFLEKLKKDVEFLAQLKLMDYSLLVGI    211 - 280
HDVERAEQEEVECEENDGEEEGESDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRK    281 - 350
EVYFMAIIDILTHYDAKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFLDFIGHILT                  351 - 406
//

Text Mined References (55)

PMID Year Title
25578879 2015 PI(5)P regulates autophagosome biogenesis.
25548108 2014 Association study indicates a protective role of phosphatidylinositol-4-phosphate-5-kinase against tardive dyskinesia.
25495341 2015 The function of phosphatidylinositol 5-phosphate 4-kinase ? (PI5P4K?) explored using a specific inhibitor that targets the PI5P-binding site.
25025909 2014 Genetic variations of PIP4K2A confer vulnerability to poor antipsychotic response in severely ill schizophrenia patients.
24788727 2014 PIPKII? is widely expressed in hematopoietic-derived cells and may play a role in the expression of alpha- and gamma-globins in K562 cells.
24681948 2015 A targeted knockdown screen of genes coding for phosphoinositide modulators identifies PIP4K2A as required for acute myeloid leukemia cell proliferation and survival.
24209622 2013 Depletion of a putatively druggable class of phosphatidylinositol kinases inhibits growth of p53-null tumors.
24086693 2013 Tamoxifen inhibition of kv7.2/kv7.3 channels.
24081551 2013 Enzyme activity of the PIP4K2A gene product polymorphism that is implicated in schizophrenia.
23996088 2013 Variation at 10p12.2 and 10p14 influences risk of childhood B-cell acute lymphoblastic leukemia and phenotype.
23758345 2013 Evolutionarily conserved structural changes in phosphatidylinositol 5-phosphate 4-kinase (PI5P4K) isoforms are responsible for differences in enzyme activity and localization.
23739505 2013 [Association of (N251S)-PIP5K2A with schizophrenic disorders: a study of the Russian population of Siberia].
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21377334 2011 Expression of PIP4K2A in lymphocyte cell lines from a sample of schizophrenia patients with previous evidence for association.
21269460 2011 Initial characterization of the human central proteome.
21124964 2010 In silico ascription of gene expression differences to tumor and stromal cells in a model to study impact on breast cancer outcome.
21041608 2011 Family-based analysis of genetic variation underlying psychosis-inducing effects of cannabis: sibling analysis and proband follow-up.
20583997 2010 PIP4Kbeta interacts with and modulates nuclear localization of the high-activity PtdIns5P-4-kinase isoform PIP4Kalpha.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19937977 2010 Association study of NRG1, DTNBP1, RGS4, G72/G30, and PIP5K2A with schizophrenia and symptom severity in a Hungarian sample.
19896968 2010 Localization, regulation and function of type II phosphatidylinositol 5-phosphate 4-kinases.
19656170 2009 PIP4KIIA and beta-globin: transcripts differentially expressed in reticulocytes and associated with high levels of Hb H in two siblings with Hb H disease.
19644675 2009 PIP5K2A-dependent regulation of excitatory amino acid transporter EAAT3.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19475563 2010 Association analysis of the PIP4K2A gene on chromosome 10p12 and schizophrenia in the Irish study of high density schizophrenia families (ISHDSF) and the Irish case-control study of schizophrenia (ICCSS).
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19328558 2009 Case-control association study of 65 candidate genes revealed a possible association of a SNP of HTR5A to be a factor susceptible to bipolar disease in Bulgarian population.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18545987 2008 A schizophrenia-linked mutation in PIP5K2A fails to activate neuronal M channels.
18364242 2008 Regulation of extranuclear PtdIns5P production by phosphatidylinositol phosphate 4-kinase 2alpha.
18314871 2008 Association of PIP5K2A with schizophrenia: a study in an indonesian family sample.
17555944 2007 The PIP5K2A gene and schizophrenia in the Chinese population--a case-control study.
17410640 2007 The PIP5K2A and RGS4 genes are differentially associated with deficit and non-deficit schizophrenia.
16823801 2006 Association study between genetic variants at the PIP5K2A gene locus and schizophrenia and bipolar affective disorder.
16801950 2006 Evidence for association of DNA sequence variants in the phosphatidylinositol-4-phosphate 5-kinase IIalpha gene (PIP5K2A) with schizophrenia.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16094259 2005 Screening of PIP5K2A promoter region for mutations in bipolar disorder and schizophrenia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15046600 2004 Btk-dependent regulation of phosphoinositide synthesis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14614854 2003 BTK regulates PtdIns-4,5-P2 synthesis: importance for calcium signaling and PI3K activity.
14614850 2003 Branches of the B cell antigen receptor pathway are directed by protein conduits Bam32 and Carma1.
14582145 2003 Polymorphism screening of PIP5K2A: a candidate gene for chromosome 10p-linked psychiatric disorders.
12509423 2003 Protein kinase C mediates translocation of type II phosphatidylinositol 5-phosphate 4-kinase required for platelet alpha-granule secretion.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9367159 1997 A new pathway for synthesis of phosphatidylinositol-4,5-bisphosphate.
8869744 1996 The phosphatidylinositol 4-phosphate 5-kinase family.
7852364 1995 The sequence of phosphatidylinositol-4-phosphate 5-kinase defines a novel family of lipid kinases.
7639683 1995 The cloning and sequence of the C isoform of PtdIns4P 5-kinase.
7629060 1995 Rho family GTPases bind to phosphoinositide kinases.