Property Summary

NCBI Gene PubMed Count 54
PubMed Score 95.55
PubTator Score 63.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
non primary Sjogren syndrome sicca 840 1.6e-02
Disease Target Count Z-score Confidence
Metal allergy 3 3.549 1.8
Cancer 2346 3.227 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.200 1.6e-02

Protein-protein Interaction (4)

Gene RIF (40)

PMID Text
26261583 High PinX1 expression significantly correlated with a worse 5-year overall and disease-specific survival in gliomas.
26211574 PinX1 protein expression is decreased in colorectal cancer patients and predicts a poor prognosis.
26194824 The stability of PinX1 is maintained in nucleolus in the presence of TERT.
26187699 Data show a novel molecular mechanism for PINX1 as an attenuator of estrogen receptor activity in breast cancer cell lines, furthering its role as a tumor suppressor gene in breast cancer.
26033551 PinX1 negatively regulated ccRCC metastasis and the expression of MMP-2 and NF-kappaB-p65
25888829 PinX1 expression was an independent negative prognostic factor for breast cancer patients.
25746325 Two novel markers, rs7840785 (PINX1) and rs7844465 (ZHX2), are significantly associated with carotid intima-media thickness.
25698538 PinX1 inhibits cell proliferation, migration and invasion in glioma cells.
25045845 the expression of PinX1 in CSCC patients is likely a predictor of the response to paclitaxel chemotherapy.
24839934 Data confirmed that levels of PinX1 and caspase 3, 8 and 9 expression were closely linked to the poor prognosis of colorectal cancer.
24823796 The results suggest that activation of Prp43p by Gno1p/PINX1 within early pre-ribosomal particles is crucial for their subsequent maturation.
24672800 These results confirmed the role of PinX1 as a major tumor suppressor gene in breast cancer cell lines.
24415760 these findings suggested that PinX1 may maintain telomere integrity by regulating TRF1 stability and that hTERT may act as both a positive and a negative regulator of TRF1 homeostasis in a PinX1-dependent manner.
24412852 Data indicate that HPV16 E6 suppresses the expression of PinX1 via inhibiting p53 transcriptional activity, resulting in the enhancement of telomerase activity.
24268029 Down-regulation of PinX1 play an important role in the tumorigenesis and development of urothelial carcinoma of the bladder.
23912465 Overexpression of PinX1 blocked Eca109 cell proliferation and induced cell apoptosis by downregulating telomerase activity.
23341363 Suggest that PinX1 could serve as a novel predictor for response to chemoradiotherapy in esophageal squamous cell carcinoma.
22882268 Data are consistent with the earlier data that showed that PINX1 somatic mutation was rare in hepatocellular carcinomas, medulloblatomas, gastric carcinomas, and colorectal carcinomas.
22749911 Silencing of PinX1 significantly reduced the localization of telomerase to telomere during mid-late S phase, suggesting the involvement of PinX1 in the cell cycle-dependent trafficking of hTERT to telomere.
22404213 Knockdown of PIN2/TERF1 interacting, telomerase inhibitor 1 (PINX1) by siRNA enhances HIV-1 replication in CD4+/CCR5+/CXCR4+ TZM-bl HeLa cells
22331467 one function of PinX1 is to stabilize TRF1 during mitosis, perhaps to promote transition into M phase of the cell cycle.
22316341 PinX1 may play important roles in NPC proliferation, migration and apoptosis and has application potential in tumor-targeted gene therapy
21119197 the telomerase inhibitor PinX1 is recruited to telomeres by TRF1 and provides a critical link between TRF1 and telomerase inhibition to prevent telomere elongation and help maintain telomere homeostasis.
20620128 these results suggest that the C-terminal fragment of LPTS/PinX1 (LPTS/PinX1(290-328)) contains a telomerase inhibitory domain that is required for the inhibition of telomere elongation and the induction of cell crisis.
20573420 Polo-like kinase 1 (Plk1) is a novel interacting protein of PinX1 and may negatively regulate the stability of PinX1 by mitotic phosphorylation.
20544396 Suppression of telomerase activity mediated by PinX1 is involved in the Mad1/c-Myc pathway.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20367640 loss of PinX1 is an adverse independent molecular marker for epithelial ovarian carcinoma patients.
20056641 Observational study of gene-disease association. (HuGE Navigator)
19553660 The results indicate that PinX1 plays an important role in faithful chromosome segregation in mitosis.
19393617 PinX1 is recruited to chromosome periphery by Nucleolin and a complex of PinX1 and Nucleolin is essential for faithful chromosome congression.
19265708 Results show that hPinX1 regulates the nucleolar accumulation and telomeric association of TRF1.
19117989 Results reveal a novel positive role for PinX1 in telomerase/telomere regulations and suggest that the constitutive expression of PinX1 attributes to telomere maintenance by telomerase and tumorigenicity in cancer cells.
18784941 PINX1 may play major role in gastric cancer development and regulate it through different pathways and expression is a sign of cancer development.
15637589 LOH of PINX1 locus associated with reduced expression of PINX1 in gastric cancer
15381700 in vitro PinX1 binds directly to the hTERT protein subunit, primarily to the hTR-binding domain, as well as to the hTR subunit
14984932 molecular cloning of the 5'-flanking region and determination of the transcription initiation site and four DNase I hypersensitive sites
12508358 Data show that liver-related putative tumor suppressor gene (LPTS) mutations occur in hepatocellular carcinoma but are infrequent and of little effect on the telomerase inhibitory function of the protein.
12439923 Over-expression of LPTS-L can induce hepatoma cells into crisis due to the reduction of telomerase activity.
12107183 role in rRNA and small nucleolar RNA maturation, not in telomere elongation inhibition

AA Sequence

MSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGLGAQEQGATDHIKVQVKNNHLGLGAT      1 - 70
INNEDNWIAHQDDFNQLLAELNTCHGQETTDSSDKKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSK     71 - 140
TDLDCIFGKRQSKKTPEGDASPSTPEENETTTTSAFTIQEYFAKRMAALKNKPQVPVPGSDISETQVERK    141 - 210
RGKKRNKEATGKDVESYLQPKAKRHTEGKPERAEAQERVAKKKSAPAEEQLRGPCWDQSSKASAQDAGDH    211 - 280
VQPPEGRDFTLKPKKRRGKKKLQKPVEIAEDATLEETLVKKKKKKDSK                          281 - 328
//

Text Mined References (60)

PMID Year Title
26261583 2015 PinX1 is up-regulated and associated with poor patients' survival in gliomas.
26211574 2015 Decreased expression of PinX1 protein predicts poor prognosis of colorectal cancer patients receiving 5-FU adjuvant chemotherapy.
26194824 2015 Increased Stability of Nucleolar PinX1 in the Presence of TERT.
26187699 2015 Novel role for PINX1 as a coregulator of nuclear hormone receptors.
26033551 2015 PinX1 serves as a potential prognostic indicator for clear cell renal cell carcinoma and inhibits its invasion and metastasis by suppressing MMP-2 via NF-?B-dependent transcription.
25888829 2015 PinX1 inhibits the invasion and metastasis of human breast cancer via suppressing NF-?B/MMP-9 signaling pathway.
25746325 2015 Genetic association and gene-smoking interaction study of carotid intima-media thickness at five GWAS-indicated genes: the Bogalusa Heart Study.
25698538 2015 PinX1 inhibits cell proliferation, migration and invasion in glioma cells.
25045845 2014 The telomere/telomerase binding factor PinX1 regulates paclitaxel sensitivity depending on spindle assembly checkpoint in human cervical squamous cell carcinomas.
24839934 2014 PinX1 without the G-patch motif suppresses proliferation, induces senescence, but does not inhibit telomerase activity in colorectal cancer SW480 cells.
24823796 2014 The telomerase inhibitor Gno1p/PINX1 activates the helicase Prp43p during ribosome biogenesis.
24672800 2014 The role of PinX1 in growth control of breast cancer cells and its potential molecular mechanism by mRNA and lncRNA expression profiles screening.
24415760 2014 PinX1, a telomere repeat-binding factor 1 (TRF1)-interacting protein, maintains telomere integrity by modulating TRF1 homeostasis, the process in which human telomerase reverse Transcriptase (hTERT) plays dual roles.
24412852 2014 PinX1, a novel target gene of p53, is suppressed by HPV16 E6 in cervical cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24268029 2013 PinX1 suppresses bladder urothelial carcinoma cell proliferation via the inhibition of telomerase activity and p16/cyclin D1 pathway.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23912465 2013 Expression and mechanism of PinX1 and telomerase activity in the carcinogenesis of esophageal epithelial cells.
23341363 2013 The telomere/telomerase binding factor PinX1 is a new target to improve the radiotherapy effect of oesophageal squamous cell carcinomas.
22882268 2012 Somatic mutation of PINX1 gene is rare in common solid cancers.
22749911 2012 PinX1 is involved in telomerase recruitment and regulates telomerase function by mediating its localization.
22331467 2012 PinX1 localizes to telomeres and stabilizes TRF1 at mitosis.
22316341 2012 PinX1 regulation of telomerase activity and apoptosis in nasopharyngeal carcinoma cells.
21909108 2011 Meta-analysis of genome-wide association studies from the CHARGE consortium identifies common variants associated with carotid intima media thickness and plaque.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21119197 2011 Telomerase inhibitor PinX1 provides a link between TRF1 and telomerase to prevent telomere elongation.
21060863 2010 Four novel Loci (19q13, 6q24, 12q24, and 5q14) influence the microcirculation in vivo.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20620128 2010 C-terminal amino acids 290-328 of LPTS/PinX1 confer telomerase inhibition.
20573420 2010 Plk1-mediated mitotic phosphorylation of PinX1 regulates its stability.
20544396 2010 PinX1 inhibits telomerase activity in gastric cancer cells through Mad1/c-Myc pathway.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20367640 2010 Decreased expression of PinX1 protein is correlated with tumor development and is a new independent poor prognostic factor in ovarian carcinoma.
20056641 2010 Multiple genetic variants in telomere pathway genes and breast cancer risk.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19553660 2009 PinX1 is a novel microtubule-binding protein essential for accurate chromosome segregation.
19393617 2009 PinX1 is recruited to the mitotic chromosome periphery by Nucleolin and facilitates chromosome congression.
19265708 2009 Human PinX1 mediates TRF1 accumulation in nucleolus and enhances TRF1 binding to telomeres.
19117989 2009 Silencing PinX1 compromises telomere length maintenance as well as tumorigenicity in telomerase-positive human cancer cells.
18784941 2009 The correlation of genetic instability of PINX1 gene to clinico-pathological features of gastric cancer in the Chinese population.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18202258 2008 A shared docking motif in TRF1 and TRF2 used for differential recruitment of telomeric proteins.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17389648 2007 Conserved interactions of the splicing factor Ntr1/Spp382 with proteins involved in DNA double-strand break repair and telomere metabolism.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17198684 2007 Characterization of a novel effect of hPinX1 on hTERT nucleolar localization.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15637589 2005 Loss of heterozygosity and histone hypoacetylation of the PINX1 gene are associated with reduced expression in gastric carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15381700 2004 Characterization of interactions between PinX1 and human telomerase subunits hTERT and hTR.
15044100 2004 Human MCRS2, a cell-cycle-dependent protein, associates with LPTS/PinX1 and reduces the telomere length.
14984932 2004 Cloning and characterization of the promoter region of human LPTS/PinX1 gene.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508358 2003 Mutation analysis of novel human liver-related putative tumor suppressor gene in hepatocellular carcinoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12439923 2002 Over-expression of LPTS-L in hepatocellular carcinoma cell line SMMC-7721 induces crisis.
12107183 2002 The yeast homolog of human PinX1 is involved in rRNA and small nucleolar RNA maturation, not in telomere elongation inhibition.
11701125 2001 The Pin2/TRF1-interacting protein PinX1 is a potent telomerase inhibitor.
11003615 2000 Identification of the gene for a novel liver-related putative tumor suppressor at a high-frequency loss of heterozygosity region of chromosome 8p23 in human hepatocellular carcinoma.