Property Summary

NCBI Gene PubMed Count 58
PubMed Score 100.20
PubTator Score 63.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
non primary Sjogren syndrome sicca 891 1.6e-02
Disease Target Count Z-score Confidence
Metal allergy 5 3.533 1.8
Cancer 2499 3.265 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.200 1.6e-02

Protein-protein Interaction (4)

Gene RIF (42)

AA Sequence

MSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGLGAQEQGATDHIKVQVKNNHLGLGAT      1 - 70
INNEDNWIAHQDDFNQLLAELNTCHGQETTDSSDKKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSK     71 - 140
TDLDCIFGKRQSKKTPEGDASPSTPEENETTTTSAFTIQEYFAKRMAALKNKPQVPVPGSDISETQVERK    141 - 210
RGKKRNKEATGKDVESYLQPKAKRHTEGKPERAEAQERVAKKKSAPAEEQLRGPCWDQSSKASAQDAGDH    211 - 280
VQPPEGRDFTLKPKKRRGKKKLQKPVEIAEDATLEETLVKKKKKKDSK                          281 - 328
//

Text Mined References (63)

PMID Year Title