Property Summary

NCBI Gene PubMed Count 276
PubMed Score 590.21
PubTator Score 576.28

Knowledge Summary

Patent (6,852)

Expression

  Differential Expression (10)

Disease log2 FC p
esophageal adenocarcinoma -1.100 1.8e-02
osteosarcoma -1.100 1.3e-03
glioblastoma -1.500 1.2e-03
sonic hedgehog group medulloblastoma -1.900 9.2e-07
atypical teratoid / rhabdoid tumor -1.600 2.4e-08
medulloblastoma, large-cell -2.500 2.8e-06
primitive neuroectodermal tumor -1.600 2.6e-06
colon cancer -1.400 5.8e-05
pediatric high grade glioma -1.400 7.7e-05
spina bifida -1.359 4.5e-02

Protein-protein Interaction (7)

Gene RIF (281)

PMID Text
26555609 results indicate that PINK1 expression is positively regulated by NRF2 and that the NRF2-PINK1 signaling axis is deeply involved in cell survival.
26471730 Rab8A GTPase Ser(111) phosphorylation is not directly regulated by PINK1 in vitro and demonstrate in cells the time course of Ser(111) phosphorylation of Rab8A, 8B and 13 is markedly delayed compared to phosphorylation of Parkin at Ser(65).
26436374 Differential submitochondrial localization of PINK1 serves as a molecular switch for mediating two distinct mitochondrial signaling pathways in maintenance of mitochondrial homeostasis.
26282903 PINK1 variants are prevalent for causing Parkinson's disease in India
26266977 two receptors previously linked to xenophagy, NDP52 and optineurin, are the primary receptors for PINK1- and parkin-mediated mitophagy
26245297 High expression of PARK6 might lead to the occurrence of non-small-cell lung cancer.
26101826 pathogenic PINK1 mutants which are not cleaved by PARL affect PINK1 kinase activity and the ability to induce PARK2-mediated mitophagy.
26071202 These results suggest that pyruvate is required for CCCP-induced PINK1/PARK2-mediated mitophagy.
26070385 Suggest a protective role of PINK1/Parkin-mediated mitophagy against chlorpyrifos-induced neuroapoptosis.
26046594 Processing and shuttling of PINK1 through mitochondria is conformed to at least three possible functional microcompartments for PINK1 activity (I, cytosol; II, outer mitochondrial membrane; III, inside mitochondria).
25987559 Cytosolic PINK1 is stabilized by TRAF6/NF-kappaB activation via Lys-63-linked ubiquitination.
25969509 PINK1 phosphorylates both Ser65 (S65) in the UB(ubiquitin)-like domain of PARKIN and the conserved Ser in UB itself.
25899925 mutant G309D PINK1 significantly reduced phosphorylation of GSK3beta at serine 9, suggesting that alterations in GSK3beta activity play an essential role in mutant G309D PINK1-induced tau phosphorylation at the PHF-1 site
25861987 Parkin, PINK1, and alpha-Synuclein have roles in stress-induced mitochondrial morphological remodeling, which may have a role in Parkinson's disease
25849934 Recessively inherited Parkin and PTEN-induced putative kinase 1 (PINK1) mutations have been investigated in this context and the present review describes the first insights gained from studies in iPSC-derived dopaminergic neurons
25849933 In the present review, we emphasize the functional overlap between the PINK1-Parkin pathway and the endoplasmic reticulum (ER)-mitochondria interface, a subcellular compartment critically involved in neurodegeneration.
25849931 In this review, we summarize the biochemical mechanisms that underlie the association of PINK1 with mitochondria under normal and pathological conditions
25849930 Unravelling the regulatory mechanisms of PINK1 is essential for a full comprehension of its kinase function in health and disease.
25849928 The results of the combined in silico simulations-based and experimental assay-based study indicates that PINK1-dependent Ser65 phosphorylation of Parkin is required for its activation and triggering of 'opening' conformations.
25785991 TGF-beta1 induces lung epithelial cell mitochondrial ROS and depolarization and stabilizes the key mitophagy initiating protein, PINK1
25714760 PINK1-PARK2 pathway-mediated mitophagy plays a key regulatory role in CSE-induced mitochondrial ROS production and cellular senescence in human bronchial epithelial cells
25700839 PINK1 phosphorylates Ser65 in both the Parkin ubiquitin-like domain and ubiquitin itself. These phosphorylation events cooperate to relieve the Parkin autoinhibition.
25611507 Augmenting mitophagy by activating the PINK1/Parkin pathway is an attractive target for therapeutic intervention for Parkinson disease and a variety of maternally inherited mitochondrial diseases.
25609704 PINK1 utilizes a mitochondrial localization mechanism that is distinct from that of conventional MTS proteins and that presumably functions in conjunction with the Tom complex in OMM localization when the conventional N-terminal MTS is inhibited.
25562319 data indicate that PINK1 deficiency results in swollen, dysfunctional mitochondria and defective mitophagy, and promotes fibrosis in the aging lung.
25558820 PINK1 mutations linked with neurogeneration on Guam.
25557302 PINK1 regulates mitochondrial respiratory function, reactive oxygen species generation, and mitochondrial transport. Moreover, recent studies implicate processed PINK1 in cytosolic signaling cascades that promote cell survival and neuron differentiation.[Review]
25557247 These data suggest that PINK1 positively regulates TG2 activity, which may be closely associated with aggresome formation in neuronal cells.
25553463 relationship between cancer rates and PD might be related to the involvement of common pathways in both diseases. This paper provides a concise overview on the cellular functions of the PINK1 and Parkin
25545816 This paper reports the first quantitative data on limb hypokinesia during gait in heterozygous PINK1 mutation carriers
25527497 Data clarify the regulation of PINK1 through multisite phosphorylation.
25404737 our data identify ATP as a key regulator for Parkin mitochondrial translocation and sustaining elevated PINK1 levels during mitophagy. PINK1 functions as an AND gate and a metabolic sensor coupling biogenetics of cells
25375667 Generated a complete structural model of human Parkin and studied phosphorylation of Parkin by PINK1.
25354644 Common genetic variants of the PINK1 and PARL genes are unlikely to be involved in schizophrenia.
25345844 The discovery of mutations in genes encoding protein kinase PTEN-induced kinase 1 (PINK1) and E3 ubiquitin ligase Parkin in familial Parkinson's disease
25305081 our results uncovered a mechanism by which PINK1-HDAC3 network mediates p53 inhibitory loop in response to oxidative stress-induced damage.
25260493 These results provide new insights into potential cooperative roles of PINK1 and PGC-1alpha in mitochondrial fatty acid oxidation, suggesting possible regulatory roles for mitochondrial function in the pathogenesis of Alzheimer disease and diabetes.
25226871 The PINK1 p.Q456X mutation leads to a decrease in mRNA and a loss of protein function
25217637 The work positions smARF upstream of PINK1 and Parkin and demonstrates that mitophagy can be triggered by intrinsic signaling cascades.
25164310 This reported the first follow-up evaluation of motor and nonmotor clinical features in PINK1 mutation carriers.
25108683 PINK1 expression is tightly regulated at its transcription level and NFkappaB is a positive regulator for PINK1 expression.
25088558 Cells exposed to severe and irreparable mitochondrial damage agents such as valinomycin can undergo PINK1-Parkin-dependent apoptosis. The proapoptotic response elicited by valinomycin is associated with the degradation of Mcl-1.
24962176 the phosphorylation activity seen in PINK1 and PARKIN can differentiate between age-matched controls and Parkinson's disease patients
24798695 This study shows that PARK13 and PINK1 are subcellular-specific, but dynamic, proteins with a reciprocal molecular relationship.
24792327 Cells lacking Pink1 were more sensitive to cell death induced by C2-Ceramide. In the same cell lines, mitochondrial morphology was fragmented by forskolin. Pink1 may exert a neuroprotective role in part by limiting mitochondrial fission.
24784582 results show that PINK1-dependent phosphorylation of both parkin and ubiquitin is sufficient for full activation of parkin E3 activity; findings demonstrate that phosphorylated ubiquitin is a parkin activator
24751806 the PINK1-mediated reduction of autophagic key factors during stress resulted in increased cell death.
24751536 These results explain a feed-forward mechanism of PINK1-mediated initiation of Parkin E3 ligase activity.
24743735 The functional interaction of mortalin with Parkin and PINK1, was investigated.
24681957 PINK1 has tumor-promoting properties and PINK1 functions as a regulator of the cell cycle.
24677602 high prevalence of heterozygous mutations in PARK2 and the novel heterozygous and homozygous point mutations in PINK1 observed in familial and sporadic cases from various states of Mexico
24660806 PINK1 controls parkin activity by phosphorylating parkin at serine-65.
24626860 Results show that PINK1 dependent phosphorylation signaling may regulate nuclear activities.
24475098 BAG5 protects against mitochondrial oxidative damage through regulating PINK1 degradation.
24446486 Mitochondria-derived vesicles require PINK1 expression and ultimately target to lysosomes for degradation.
24385196 PINK1G309D, the loss-of-function mutation associated with early-onset familial Parkinson's disease, promotes expression of VCAM-1 and exacerbates attachment of monocytes to brain endothelial cells.
24383081 this data correlate BAG2 to PINK1 for the first time, strengthening the important role of BAG2 in Parkinson disease -related neurodegeneration.
24374372 Our findings highlight a potential novel function of extramitochondrial PINK1 in dopaminergic neurons
24357652 Two distinct cellular pools of PINK1 have different effects on Parkin translocation and mitophagy.
24189060 Formation of phosphorylated PINK1 dimer stimulates Parkin recruitment in HeLa mitochondria.
24184327 PINK1 expression is significantly increased upon CCCP-induced mitophagy in a calcium-dependent manner. PINK1 may play a role in mitophagy that is downstream of ubiquitination of mitochondrial substrates
24151868 Our data support a novel role for PINK1 in regulating dendritic morphogenesis.
24149988 The expression of unfolded proteins in the matrix causes the accumulation of PINK1 on energetically healthy mitochondria, resulting in mitochondrial translocation of PARK2, mitophagy and subsequent reduction of unfolded protein load.
24149440 Blockade of mitochondrial protein import triggers the recruitment of PARK2, by PINK1, to the TOMM machinery.
24128678 PINK1 mRNA and protein are reduced in human amyotrophic lateral sclerosis muscle.
24121706 PINK1 steady-state elimination by the N-end rule identifies a novel organelle to cytoplasm turnover pathway that yields a mechanism to flag damaged mitochondria for autophagic elimination.
23986421 The frequency of the PARK2, PINK1, PARK7 mutations among Polish EO-PD patients seems to be low.
23885119 These results indicate that association of PINK1 with SARM1 and TRAF6 is an important step for mitophagy.
23751051 study found dissipation of mitochondrial membrane potential triggers phosphorylation of PINK1 and Parkin and, in response, Parkin translocates to depolarized mitochondria; Parkin's E3 activity is re-established concomitant with ubiquitin-ester formation at Cys431 of Parkin; as a result mitochondrial substrates in neurons become ubiquitylated
23533695 PINK1 is posttranslationally processed, whose level is definitely regulated in healthy steady state of mitochondria.
23525905 Overexpression of TRAP1 is able to mitigate Pink1 but not parkin loss-of-function phenotypes.
23519076 PINK1 protects against cell death induced by mitochondrial depolarization, by phosphorylating Bcl-xL and impairing its pro-apoptotic cleavage.
23472196 PINK1 is imported into mitochondria by a unique pathway that is independent of the TOM core complex but crucially depends on the import receptor Tom70
23459931 PINK1 kinase function could be restored for a subset of patients with PINK1 mutations, and perhaps alter the course of their disease.
23393160 AF-6 is a positive modulator of the PINK1/parkin pathway and is deficient in Parkinson's disease.
23319602 PINK1 activates the formation of a Parkin-ubiquitin thioester intermediate, a hallmark of HECT E3 ligases, both in vitro and in vivo.
23303188 analysis of PINK1 (PTEN-induced putative kinase 1) mutations associated with Parkinson disease in mammalian cells and Drosophila
23261939 These results indicate a novel pathway by which the P209A defect in the PINK1 kinase domain inhibits oxidative stress-induced HO-1 and SOD2 induction, which may accelerate the neurodegeneration in PD with PINK1 defect.
23256036 the molecular mechanism underlying the PINK1-dependent mitochondrial translocation and activation of Parkin as an initial step of mitophagy.
23251494 results corroborate the hypothesis that PINK1 mutations result in reduced neuronal survival, most likely due to impaired cellular stress resistance
23212910 Phosphatase and tensin homolog (PTEN)-induced putative kinase 1 (PINK1)-dependent ubiquitination of endogenous Parkin attenuates mitophagy
22956510 from >5800 unique cases.The weighted mean proportion of cases with PARK2 (parkin), PINK1, and PARK7 (DJ-1) mutations was 8.6%, 3.7%, and 0.4%, respectively. PINK1 mutations were more common in Asian subjects.
22910362 Autophosphorylation of Ser228 and Ser402 in PINK1 is essential for mitochondrial localization of Parkin.
22724072 PINK1 is specifically activated by mitochondrial membrane potential depolarization, enabling it to phosphorylate Parkin at Ser(65). Activated PINK1 autophosphorylates at several residues, including Thr(257).
22643835 PINK1 positively regulates two key molecules, TRAF6 and TAK1, in the IL-1beta-mediated signaling pathway, consequently up-regulating their downstream inflammatory events
22547060 Multiple targeting signals featured by the Pink1 sequence result in the final localization of both the full-length protein and its major Deltapsi-dependent cleavage product to the cytosolic face of the outer mitochondrial membrane.
22486164 Mutations in PTEN-induced kinase 1 (PINK1) cause PARK6 type Parkinson disease.
22445250 Pathogenic mutations were not detected in SNCA, PINK1, or DJ-1 in this study.
22434215 Parkin mutation carriers showed a slightly reduced ability to recognize facial emotions that was least severe in individuals who showed the strongest increase of ventrolateral premotor activity
22354088 These results highlight a new role for MPP in PINK1 import and mitochondrial quality control via the PINK1-Parkin pathway.
22238344 The results identify MARK2 as an upstream regulator of PINK1 and DeltaN-PINK1 and provide insights into the regulation of mitochondrial trafficking in neurons and neurodegeneration in PD.
22233331 This study identified that In two families, two new PINK1 point mutations (L31X and P416L) were identified.
22212487 By preventing mitochondrial dysfunction and reinforcing anti-apoptotic and neuronal survival pathways such as PI3K/AKT, PINK1 confers a neuroprotective effect against the neurotoxin C2-ceramide.
22078885 Study shows that both PINK1 and Parkin halt mitochondrial movement; PINK1 phosphorylates Miro (1 and 2) and thereby initiates the rapid degradation of Miro through a Parkin- and proteasome-dependent pathway.
22076283 PINK1-specific siRNA remarkably downregulated Bcl-xL and TRAP1 proteins and upregulated BAX protein expression.
22057787 PINK1 and parkin are associated with autosomal recessive parkinsonism and can functionally interact to maintain mitochondrial integrity and to promote clearance of damaged and dysfunctional mitochondria.
22048964 DLGAP5-PINK1 and BUB1B-PINK1 were strong predictors of disease-free survival and overall survival, respectively, among adult patients with ACT.
22043288 results provide insight into the molecular pathology of PINK1 mutations in Parkinson disease and also confirm the critical role of substrate availability in determining the biochemical phenotype
21925922 This study showed that the role played by PINK1 in early onset parkinsonism in southern Italy and illustrate the existence of mutations in this gene also in the late-onset form of the disease
21784538 molecular genetics and functions of PINK1 in Parkinson's disease (Review)
21743139 Two SNPs c.189C>T and c.960-5G>A may contribute to the risk of early-onset Parkinsonism in Chinese Han people.
21677397 association study revealed a significant association between Asn521Thr variation in PINK1 gene and type 2 diabetes suggesting that PINK1 gene Thr521 allele carriers have significantly increased susceptibility to type 2 diabetes
21606348 Data demonstrate that PINK1 activity is crucial for postnatal myocardial development, through its role in maintaining mitochondrial function, and redox homeostasis in cardiomyocytes.
21426348 the PARL-catalyzed removal of the Pink1 signal sequence in the canonical import pathway acts as a cellular checkpoint for mitochondrial integrity
21412950 Phylogenetic and in silico structural analysis of the Parkinson disease-related kinase PINK1
21408142 The impact of mutations in endogenous PINK1 and Parkin on the ubiquitination of mitochondrial fusion and fission factors and the mitochondrial network structure, was investigated.
21366594 These results indicate a novel pathway by which the defect of PINK1 inhibits the oxidative stress-induced HO-1 production
21322020 Mutations in PINK1 were not observed among Iranian parkinson disease patients
21242281 We show that silencing PINK1 is synthetically lethal with MMR deficiency in cells with MSH2, MLH1, or MSH6 dysfunction
21187721 PINK1 and Parkin physically associate and functionally cooperate to identify and label damaged mitochondria for selective degradation via autophagy.
21177249 PINK1 exerts its cytoprotective function not only in mitochondria but also in the cytoplasm through activation of mTORC2
21145388 observed PINK1 immunostaining in both AD and MS lesions, predominantly in reactive astrocytes associated with these lesions, suggesting that the increase in astrocytic PINK1 protein might be an intrinsic protective mechanism to limit cellular injury.
21138942 Mitochondrial protease PARL cleaves PINK1 at position A103.
20971498 our findings indicate that the physiologic functions of PINK1 go beyond its regulatory role of mitochondria-mediated cell survival in neurons.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20871098 Ubiquitination of several mitochondrial proteins, including mitofusin 1 and mitofusin 2 were reduced following the silencing of parkin or PINK1.
20842103 Data show that mitochondrial fragmentation induced by expression of alpha-synuclein is rescued by coexpression of PINK1, parkin or DJ-1 but not the PD-associated mutations PINK1 G309D and parkin Delta1-79 or by DJ-1 C106A.
20798600 Data suggest that reduced binding of PINK1 to Parkin leads to failure in Parkin mitochondrial translocation, resulting in the accumulation of damaged mitochondria, which may contribute to disease pathogenesis.
20637729 The phosphorylation of p66(Shc) at Ser36 is significantly increased in PINK1 deficient cell lines under normal tissue culture conditions, further still in the presence of compounds which elicit oxidative stress.
20558144 Results from the present study showed that point mutations and homozygous exonic deletions in PINK1 are not a common cause of PD in the South African population.
20558144 Observational study of gene-disease association. (HuGE Navigator)
20547144 A mutation in PINK1 (Arginine492X) results in mitochondrial dysfunction and oxidative stress.
20513816 This study findings strengthen the hypothesis that heterozygous PINK1 mutations act as a susceptibility factor to develop at least subtle Parkinson disease motor.
20508036 Data show that mitochondrial accumulation of full-length PINK1 is sufficient but not necessary for the stress-induced loss of Parkin signal and its mitochondrial translocation.
20506312 Studies indicate that molecular genetic analyses have identified five disease genes associated with familial Parkinson disease; SNCA, PARK2, PINK1, PARK7 and LRRK2.
20483373 Observational study of gene-disease association. (HuGE Navigator)
20461815 Meta-analysis of gene-disease association. (HuGE Navigator)
20404107 Data show that PINK1 is degraded in a mitochondrial membrane potential-dependent manner, and that PINK1 recruits Parkin from the cytoplasm to mitochondria with low membrane potential to initiate the autophagic degradation of damaged mitochondria.
20399249 Mutations in parkin gene are common in Chinese EOPD patients, and mainly are exon rearrangements, while mutation in PINK1 might be not common in Chinese EOPD patients.
20399249 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20376796 The exon CNV in the PINK1 gene was rare in Chinese patients with autosomal recessive early-onset Parkinsonism.
20376796 Observational study of gene-disease association. (HuGE Navigator)
20356854 Two mutations were identified in PINK1 that are associated with an early-onset, slowly progressive form of Parkinson's disease in a large Spanish family.
20179104 There is a Drp1- and Fis1-induced, and PINK1-mediated protection mechanism in senescent cells.
20171192 These findings suggest that both PINK1 and parkin play important roles in regulating the formation of Lewy bodies during the pathogenesis of sporadic and familial Parkinson's disease.
20164189 mutant PINK1 mitochondrial perturbations can be rescued by the mitochondrial division inhibitor mdivi-1
20153330 study shows PINK1 in combination with parkin results in the perinuclear mitochondrial aggregation followed by their elimination; results suggest mitophagy controlled by the PINK1/parkin pathway might be associated with Parkinson's disease pathogenesis
20146068 Mutations of DJ-1 and PINK1 gene are also found in Chinese patients with sporadic early onset parkinsonism.
20146068 Observational study of gene-disease association. (HuGE Navigator)
20098416 PINK1 kinase activity and its mitochondrial localization sequence are prerequisites to induce translocation of the E3 ligase Parkin to depolarized mitochondria.
20045449 Our data indicate that PINK1 plays an important and specific physiological role in protecting cells from proteasomal stress, and suggest that PINK1 might exert its cytoprotective effects upstream of mitochondria engagement.
20034704 The results of this study indicated that genetic variants at the parkin and PINK1 loci do not play a critical role in the pathogenesis of multiple system atrophy.
20034704 Observational study of gene-disease association. (HuGE Navigator)
20012177 PINK1, Omi/HtrA2 and parkin participate at different levels in mitochondrial quality control, converging through some overlapping and some distinct steps to maintain a common phenotype of healthy mitochondrial networks [REVIEW]
19944740 The interaction of PINK1 SNP IVS1-7 A-->G and environmental risk factors is associated with a significant effect in anticipating the disease clinical onset.
19944740 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19904588 coexistence of mutations in PINK1 and complex I genes appear to have an impact on the development of the parkinsonism [REVIEW]
19890973 The data of this study indicated that olfactory dysfunction is common in PINK1 Parkinsonism and consists typically in defective odor identification and discrimination.
19889566 This study suggested that three SNPs (rs3738133 or rs7550319 and rs3738136 & rs1043424) could be preferably used for the Indian population groups for genetic studies utilizing PINK1 markers.
19889566 Observational study of gene-disease association. (HuGE Navigator)
19880420 Phosphorylation of parkin by PINK1 activates parkin E3 ligase function and NF-kappaB signaling.
19847793 study experimental evidence that clinically reported PINK1 heterozygous mutations exert a gene dosage effect, suggesting that haploinsufficiency of PINK1 is the most likely mechanism that increased the susceptibility to dopaminergic cellular loss
19822161 The responsiveness to distracting stimuli is decreased in asymptomatic PINK1 mutation carrier.
19822161 Observational study of gene-disease association. (HuGE Navigator)
19726410 Observational study of gene-disease association. (HuGE Navigator)
19692353 LRRK2 with other Parkinson's disease causing genes, Parkin, DJ-1 and PINK-1.
19562775 No pathogenic mutation of PINK1 was seen in a Brazilian cohort of early-onset Parkinson disease patients, supporting the hypothesis that mutations in PINK1 may not be a relevant cause of EOPD.
19562775 Observational study of gene-disease association. (HuGE Navigator)
19500570 Mutations of PINK1 cause abnormal mitochondrial morphology, bioenergetic function and oxidative metabolism in human tissues; the biochemical consequences may vary between mutations.
19492085 Drp1 is dephosphorylated in PINK1 deficient cells due to activation of the calcium-dependent phosphatase calcineurin.
19405094 Observational study of gene-disease association. (HuGE Navigator)
19358826 These results indicate that Parkin regulates PINK1 stabilization via direct interaction with PINK1, and operates through a common pathway with PINK1 in the pathogenesis of early-onset Parkinson disease.
19351622 Studied the frequency of parkin and PINK1 gene mutations in early-onset Parkinson's disease; data support a trend towards a higher frequency of heterozygosity in patients compared with normal controls, but effect small and not significant in this study.
19330279 PINK1 mutation carriers showed saccade abnormalities indicating of an impaired saccadic basal ganglia path and posterior parietal cortex
19285945 PINK1-associated Parkinson's disease is caused by neuronal vulnerability to calcium-induced cell death.
19279012 PINK1 and Parkin may cooperate through different mechanisms to maintain mitochondrial homeostasis.
19276113 FOXO3a controls Pink1 transcription in both mouse and human cells subjected to growth factor deprivation, and this regulation is exerted through evolutionarily conserved FOXO binding elements
19270741 Silencing of PINK1 expression affects mitochondrial DNA and oxidative phosphorylation.
19242547 mutant PINK1 or PINK1 knock-down caused deficits in mitochondrial respiration and ATP synthesis
19229105 Functional ubiquitin E3 ligase complex consisting of parkinson disease (PD)-associated Parkin, PINK1, and DJ-1 to promote degradation of un-/misfolded proteins.
19224617 This study found that no associations were seen for PINK1 in Australia patient with Parkinson's disease
19224617 Observational study of gene-disease association. (HuGE Navigator)
19214605 Data report a third large rearrangement of PINK1, which enlarges the mutation spectrum involved in recessive early onset Parkinson's disease.
19205068 In this study identified one novel mutation in PINK1 (homozygous deletion of exon 7).
19205068 Observational study of gene-disease association. (HuGE Navigator)
19167501 Data show that parkin and PINK1 affect each other's stability, solubility and tendency to form aggresomes, and have important implications regarding the formation of Lewy bodies.
19152501 Findings suggest that Pink1 functions in the trafficking of mitochondria in cells.
19139432 Combined expression of BUB1B and PINK1 was the best predictor of overall survival in malignant adrenal cortex neoplasms. Combined expression of DLG7 and PINK1 was the best predictor of disease free survival.
19087301 The PINK1 gene in Jordanian families with incidences of young-onset and juvenile parkinsonism is identified two novel putative pathogenic substitutions, P416R and S419P, located in a conserved motif of the serine/threonine kinase domain.
19076428 Mutations in PINK1 are associated with the PARK6 autosomal recessive, early-onset, Parkinson disease-susceptibility locus
19048950 Its missense mutation causes autosomal recessive juvenile parkinsonism.
19038850 Mutations in pink1 protein,linked to recessively inherited Parkinson disease, are associated with an additional recruitment of supplementary motor area and premotor cortex during a motor sequence task.
19006224 3 patients with heterozygous PINK1 mutations (2 new:M341I & P209A)were found in a Taiwanese PD cohort, but it is dubious whether any of the novel PINK1 mutations were sufficient in the heterozygous state to cause disease.
19006224 Observational study of gene-disease association. (HuGE Navigator)
18973254 A novel missense mutation was found in exon 3 (c.709A>G;p. M237V). The high conservation of residue 237 among PINK1 homologs and its critical location in the protein kinase domain suggests that the novel M237V variant may affect PINK1 function.
18973254 Observational study of gene-disease association. (HuGE Navigator)
18957282 These results demonstrate the biochemical relationship between PINK1, Parkin, and the mitochondria and thereby suggest the possible mechanism of PINK-Parkin-associated PD pathogenesis.
18785233 Mutations of PINK1 gene are found in Chinese families with autosomal recessive early-onset Parkinsonism.
18704525 Observational study of gene-disease association. (HuGE Navigator)
18685134 Only four PINK1 mutations were pathogenic. Several PINK1 sequence variants are potentially benign and there was no evidence that PINK1 heterozygosity increases susceptibility to idiopathic Parkinson disease.
18685134 Observational study of gene-disease association. (HuGE Navigator)
18584234 Data show that higher tactile and visuo-tactile temporal discrimination threshold and temporal order judgement are detected in in PINK1 mutation carriers.
18584234 Observational study of gene-disease association. (HuGE Navigator)
18560593 phenotypic effects of PINK1 loss-of-function described here in mammalian neurons provides mechanistic insight into the age-related degeneration of nigral dopaminergic neurons seen in Parkinson disease
18546294 A new heterozygous mutation (p.R58-V59insGR) was found in exon 1 of PINK1. PINK1 mutation may modify parkin-mutation-positive Parkinsonism. PINK1 mutations may be associated with schizophrenia.
18541801 Data emphasize the importance of heterozygous PINK1 mutations as a possible risk factor for developing the common classic form of sporadic Parkinson disease.
18524835 Results show a co-segregation of a Parkinson's disease related nuclear gene (PINK1) mutation with mtDNA mutation.
18495756 PINK1 polymorphisms are associated with PINK1 transcript levels and measures of fatty acid metabolism in a concordant manner, whereas our RNAi data imply that PINK1 may indirectly influence lipid metabolism.
18495756 Observational study of gene-disease association. (HuGE Navigator)
18486522 In this study found one patient carried a p.G411S heterozygous amino acid change in the PINK1 gene.
18486522 Observational study of gene-disease association. (HuGE Navigator)
18469032 PINK1 gene mutations are linked to Parkinson disease
18397367 Our findings support a dual subcellular localization, implying that PINK1 can reside in the mitochondria and the cytosol. This raises intriguing functional roles that bridge these two cellular compartments.
18378882 Patients with Parkin or PINK1 mutations benefit from subthalamic nucleus deep brain stimulation, but clinical response is not superior to non-mutation carriers and may be limited by more advanced axial motor symptoms at a relatively early disease stage.
18378882 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18359116 Hsp90 and Cdc37 are binding partners of PINK1 which regulate its stability
18330912 retrospectively analyzed the occurrence of PINK1 heterozygous rare variants in over 1100 sporadic and familial Parkinson disease patients of all onset ages and in 400 controls
18330912 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18307263 Homozygous or compound heterozygous mutations in the PINK1 gene represent the second most frequent cause of autosomal recessive parkinsonism after Parkin protein.
18286320 Homozygous mutations in the PINK1 gene have been shown to cause early-onset parkinsonism. Here, we describe a novel homozygous mutation (Q126P), identified in two affected German sisters with a clinical phenotype typical for PINK1-associated parkinsonism.
18272063 May be involved in apoptosi, oxidative stress, and development of Parkinson disease.
18261714 Limbic and frontal cortical degeneration is associated with psychiatric symptoms in PINK1 mutation carriers.
18211709 No mutations were found in PINK1 in Parkinson disease patients from Portugal.
18211709 Observational study of genotype prevalence. (HuGE Navigator)
18068301 no PINK1 gene mutation was found in any of the probands from six Caucasian early-onset Parkinson disease families
18031932 DeltaN 54 kDa PINK1 undergoes constitutive degradation by proteasome, and underscore the significance of its localization in cytoplasm, especially in the N-terminally processed form.
18003639 document the influence of Parkin on Pink1 subcellular distribution, providing further evidence for a common pathogenic pathway in recessive Parkinson's disease
17989306 PINK1 deficiency in humans results in mitochondrial abnormalities associated with cellular stress, a pathological phenotype, which can be ameliorated by enhanced expression of parkin.
17960343 Observational study of gene-disease association. (HuGE Navigator)
17960343 The incidence of carrying PINK1 mutations in the present cohort of Taiwanese EOPD patients was low, accounting for 2/39 (5.1 %) in familial cases, and 2/99 (2 %) in sporadic cases.
17950257 humans PINK1 message is expressed in neurons with very little to no signal in glia and no difference in parkinson disease.
17766179 sleep disturbances were not found in PARK6 parkinsonism patients
17724286 Relative to controls without a mutation, Parkin and PINK1 mutation carriers displayed a bilateral increase in gray matter volume in the putamen and the internal globus pallidus
17707122 PINK1 exerts anti-apoptotic effect by inhibiting the opening of mPTP and that PARK6 mutant PINK1 loses its ability to prevent mPTP opening and cytochrome c release.
17579517 PINK1 protects against oxidative-stress-induced cell death by suppressing cytochrome c release from mitochondria, and this protective action of PINK1 depends on its kinase activity to phosphorylate TRAP1.
17567565 regulation of the PINK1 locus, linked to neurodegenerative disease, is altered in obesity, NIDDM and inactivity, while the combination of RNAi experiments and clinical data suggests a role for PINK1 in cell energetics
17557243 possible association of IVS5-5G>A polymorphism, positioned in the upstream region of exon 5 of PINK1 gene with the risk for sporadic late onset Parkinson disease (LOPD) in Chinese
17557243 Observational study of gene-disease association. (HuGE Navigator)
17362513 a mammalian non-coding antisense molecule can positively influence the abundance of a cis-transcribed mRNA; dsRNA-mediated mechanism for stabilizing the expression of svPINK1
17219214 Absence of correlation between PINK1 mRNA levels and clinical status in heterozygous mutation carriers suggests that other genetic or environmental factors play a role in determining the phenotypic variability in Parkinson disease.
17202228 affective and psychotic symptoms may be part of the phenotypic spectrum or even the sole manifestation of PINK1 mutations
17172567 Observational study of gene-disease association. (HuGE Navigator)
17172567 PINK1 mutations are rare in Norwegian patients with EOP and familial Parkinson's disease;however, the data suggest that some heterozygous mutations might increase the risk of developing Parkinson's disease
17154281 Deletion of the entire PINK1 gene and a splice site mutation (g.15445_15467del23) which produces several aberrant mRNAs in Parkinson disease.
17141510 These data indicate that PINK1 function is critical to prevent oxidative damage and that peripheral cells may be useful for studies of progression and therapy of PARK6.
17084972 Observational study of gene-disease association. (HuGE Navigator)
17084972 PINK1 A340T variant may contribute to the risk for late-onset PD in Chinese.
17055324 We genotyped eight known mutations in three clinic-based cohorts with Parkinsonism and found one homozygous p.L347P mutation in PINK1.
17017532 PINK-1 encodes the PTEN induced kinase 1 and is located to provide a link between mitochondria and the pathogenesis of Parkinson disease--REVIEW
17013904 This finding suggests a role not only of homozygous but also of heterozygous PINK1 mutations in the development of parkinsonian signs and underlines the necessity to carefully investigate family members of affected mutation carriers.
17000703 Thus, in addition to the activation segment, the C-terminal tail of PINK1 also contains regulatory motifs capable of governing PINK1 kinase activity.
16969854 Observational study of gene-disease association. (HuGE Navigator)
16969854 PINK1 mutations mutations are a significant risk factor in the development of later onset Parkinson's disease
16966503 This study extends the phenotypic and molecular spectrum of the PINK1 gene and the geographic origin of patients with PINK1 gene mutations.
16769864 Heterozygous PINK1 mutations may predispose to PD, as was previously suggested by the presence of dopamine hypometabolism in asymptomatic mutation carriers.
16700027 A patient, heterozygote for W437X mutation, was affected by Parkinson's disease and 3 further relatives were reported affected, according to an autosomal dominant transmission.
16672981 Expression of human PINK1 in the Drosophila testes restores male fertility and normal mitochondrial morphology in a portion of pink1 mutants, demonstrating functional conservation between human and Drosophila Pink1
16632486 PINK1 and DJ-1 may have a role in early-onset Parkinson's disease and physically associate and collaborate to protect cells against stress via complex formation
16547921 PINK1 mutations (homozygous nonsense and heterozygous missense) that highlight issues in Parkinson disease diagnosis.
16482571 Observational study of gene-disease association. (HuGE Navigator)
16482571 The phenotypic spectrum associated with PINK1-positive Parkinson disease patients may be wider than previously reported.
16354302 Observational study of gene-disease association. (HuGE Navigator)
16257123 Observational study of gene-disease association. (HuGE Navigator)
16226715 PINK1 participates in the protection of dopaminergic neurons
16207731 Both wild-type and mutant PINK1 proteins localize to mitochondria and prove that a short N-terminal part of PINK1 is sufficient for its mitochondrial targeting.
16157901 Observational study of gene-disease association. (HuGE Navigator)
16079129 PINK1 reduces the basal neuronal pro-apoptotic activity and protects neurons from staurosporine-induced apoptosis; loss of this protective function may underlie degeneration of nigral dopaminergic neurons in patients with PINK1 mutations
16046032 Observational study of gene-disease association. (HuGE Navigator)
16009891 Observational study of gene-disease association. (HuGE Navigator)
16009891 PINK1 homozygous mutations are a relevant cause of disease among Italian sporadic patients with early-onset parkinsonism.
15970950 Observational study of genotype prevalence. (HuGE Navigator)
15955954 A patient homozygous for A PINK1 mutation was characterized clinically. All clinical and laboratory features, including SPECT and assessment of autonomic function, were indistinguishable from typical idiopathic Parkinson disease.
15955953 Thus, early-onset PD with dementia may be considered PINK1-linked parkinsonism. Furthermore, patients with PINK1 mutations form 8.9% of parkin- and DJ-1-negative ARPD families.
15876334 Observational study of genotype prevalence. (HuGE Navigator)
15876334 The G309D and W437OPA mutations in PINK1 gene probably do not represent common causes of familial or sporadic PD in a Caucasian population.
15824318 These results show that PINK1 is processed at the N terminus in a manner consistent with mitochondrial import, but the mature protein also exists in the cytosol.
15596610 Observational study of gene-disease association. (HuGE Navigator)
15596610 Autosomal recessive mutations in PINK1 are a rare cause of young-onset Parkinson disease.
15542245 Observational study of gene-disease association. (HuGE Navigator)
15505171 Observational study of genotype prevalence. (HuGE Navigator)
15505171 Overall, these data indicate that PINK1 mutations are a rare cause of PD in Ireland.
15505170 The results indicate worldwide distribution of PARK6-linked parkinsonism.
15349870 Six novel pathogenic PINK1 mutations suggest that PINK1 may be the second most common causative gene next to parkin in parkinsonism with the recessive mode of inheritance.
15349860 Observational study of gene-disease association. (HuGE Navigator)
15349859 Observational study of gene-disease association. (HuGE Navigator)
15349859 Strong evidence indicates that, although important in mendelian forms of Parkinson's disease (PD), PINK1 does not influence the cause of sporadic nonmendelian forms of PD.
15087508 mutations in PINK1 are associated with PARK6 a locus linked to a rare familial form of Parkinson disease; cell culture studies suggest that PINK1 is mitochondrially located and may exert a protective effect on the cell that is abrogated by the mutations
12548371 PARK6 appears to be an important locus for autosomal recessive juvenile parkinsonism in Europe.
12548343 Autosomal recessive early onset parkinsonism is linked to three loci: PARK2, PARK6, and PARK7.
12447943 The subclinical loss of striatal dopamine storage capacity found in PARK6 carriers implies that the unidentified gene on the short arm of chromosome 1 exhibits either haploinsufficency or a dominant negative effect.

AA Sequence

MAVRQALGRGLQLGRALLLRFTGKPGRAYGLGRPGPAAGCVRGERPGWAAGPGAEPRRVGLGLPNRLRFF      1 - 70
RQSVAGLAARLQRQFVVRAWGCAGPCGRAVFLAFGLGLGLIEEKQAESRRAVSACQEIQAIFTQKSKPGP     71 - 140
DPLDTRRLQGFRLEEYLIGQSIGKGCSAAVYEATMPTLPQNLEVTKSTGLLPGRGPGTSAPGEGQERAPG    141 - 210
APAFPLAIKMMWNISAGSSSEAILNTMSQELVPASRVALAGEYGAVTYRKSKRGPKQLAPHPNIIRVLRA    211 - 280
FTSSVPLLPGALVDYPDVLPSRLHPEGLGHGRTLFLVMKNYPCTLRQYLCVNTPSPRLAAMMLLQLLEGV    281 - 350
DHLVQQGIAHRDLKSDNILVELDPDGCPWLVIADFGCCLADESIGLQLPFSSWYVDRGGNGCLMAPEVST    351 - 420
ARPGPRAVIDYSKADAWAVGAIAYEIFGLVNPFYGQGKAHLESRSYQEAQLPALPESVPPDVRQLVRALL    421 - 490
QREASKRPSARVAANVLHLSLWGEHILALKNLKLDKMVGWLLQQSAATLLANRLTEKCCVETKMKMLFLA    491 - 560
NLECETLCQAALLLCSWRAAL                                                     561 - 581
//

Text Mined References (281)

PMID Year Title
26555609 2015 NRF2 Regulates PINK1 Expression under Oxidative Stress Conditions.
26471730 2015 Phosphoproteomic screening identifies Rab GTPases as novel downstream targets of PINK1.
26436374 2015 Differential submitochondrial localization of PINK1 as a molecular switch for mediating distinct mitochondrial signaling pathways.
26282903 2015 Novel P-TEN-induced putative kinase 1 (PINK1) variant in Indian Parkinson's disease patient.
26266977 2015 The ubiquitin kinase PINK1 recruits autophagy receptors to induce mitophagy.
26245297 2015 Status of the Parkinson's disease gene family expression in non-small-cell lung cancer.
26101826 2015 Intramembrane protease PARL defines a negative regulator of PINK1- and PARK2/Parkin-dependent mitophagy.
26071202 2015 Pyruvate stimulates mitophagy via PINK1 stabilization.
26070385 2015 PINK1/Parkin-mediated mitophagy alleviates chlorpyrifos-induced apoptosis in SH-SY5Y cells.
26046594 2015 Shuttling of PINK1 between Mitochondrial Microcompartments Resolved by Triple-Color Superresolution Microscopy.
25987559 2015 Cytosolic PTEN-induced Putative Kinase 1 Is Stabilized by the NF-?B Pathway and Promotes Non-selective Mitophagy.
25969509 2015 Defining roles of PARKIN and ubiquitin phosphorylation by PINK1 in mitochondrial quality control using a ubiquitin replacement strategy.
25899925 2015 Parkinson's disease-associated PINK1 G309D mutation increases abnormal phosphorylation of Tau.
25861987 2015 Convergence of Parkin, PINK1, and ?-Synuclein on Stress-induced Mitochondrial Morphological Remodeling.
25849934 2015 iPS models of Parkin and PINK1.
25849933 2015 The endoplasmic reticulum/mitochondria interface: a subcellular platform for the orchestration of the functions of the PINK1-Parkin pathway?
25849931 2015 Biochemical properties of the kinase PINK1 as sensor protein for mitochondrial damage signalling.
25849930 2015 PINK1 activation-turning on a promiscuous kinase.
25849928 2015 Activation of the E3 ubiquitin ligase Parkin.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25785991 2015 Epithelial cell mitochondrial dysfunction and PINK1 are induced by transforming growth factor-beta1 in pulmonary fibrosis.
25714760 2015 PARK2-mediated mitophagy is involved in regulation of HBEC senescence in COPD pathogenesis.
25700839 2015 Molecular mechanisms underlying PINK1 and Parkin catalyzed ubiquitylation of substrates on damaged mitochondria.
25611507 2015 The roles of PINK1, parkin, and mitochondrial fidelity in Parkinson's disease.
25609704 2015 Unconventional PINK1 localization to the outer membrane of depolarized mitochondria drives Parkin recruitment.
25562319 2015 PINK1 deficiency impairs mitochondrial homeostasis and promotes lung fibrosis.
25558820 2015 Defining neurodegeneration on Guam by targeted genomic sequencing.
25557302 2015 Beyond mitophagy: cytosolic PINK1 as a messenger of mitochondrial health.
25557247 2015 PINK1 phosphorylates transglutaminase 2 and blocks its proteasomal degradation.
25553463 2015 Functions and characteristics of PINK1 and Parkin in cancer.
25545816 2015 Ultrasound-based motion analysis demonstrates bilateral arm hypokinesia during gait in heterozygous PINK1 mutation carriers.
25527497 2015 PINK1 kinase catalytic activity is regulated by phosphorylation on serines 228 and 402.
25527291 2015 Ubiquitin Ser65 phosphorylation affects ubiquitin structure, chain assembly and hydrolysis.
25404737 2015 Role of glucose metabolism and ATP in maintaining PINK1 levels during Parkin-mediated mitochondrial damage responses.
25375667 2014 Phosphorylation by PINK1 releases the UBL domain and initializes the conformational opening of the E3 ubiquitin ligase Parkin.
25354644 2015 Common variants of the PINK1 and PARL genes do not confer genetic susceptibility to schizophrenia in Han Chinese.
25345844 2015 PINK1 and Parkin – mitochondrial interplay between phosphorylation and ubiquitylation in Parkinson's disease.
25305081 2015 PINK1 positively regulates HDAC3 to suppress dopaminergic neuronal cell death.
25260493 2014 Potential roles of PINK1 for increased PGC-1?-mediated mitochondrial fatty acid oxidation and their associations with Alzheimer disease and diabetes.
25244949 2014 Hepatitis C virus core protein suppresses mitophagy by interacting with parkin in the context of mitochondrial depolarization.
25226871 2014 Early-onset Parkinson's disease due to PINK1 p.Q456X mutation--clinical and functional study.
25217637 2014 Short mitochondrial ARF triggers Parkin/PINK1-dependent mitophagy.
25164310 2014 Phenotypic variability of PINK1 expression: 12 Years' clinical follow-up of two Italian families.
25108683 2014 Upregulation of human PINK1 gene expression by NF?B signalling.
25088558 2014 PINK1 triggers autocatalytic activation of Parkin to specify cell fate decisions.
24962176 2014 Parkinson's disease biomarker: a patent evaluation of WO2013153386.
24896179 2014 The mitochondrial deubiquitinase USP30 opposes parkin-mediated mitophagy.
24798695 2014 PARK13 regulates PINK1 and subcellular relocation patterns under oxidative stress in neurons.
24792327 2014 Downregulation of Pink1 influences mitochondrial fusion-fission machinery and sensitizes to neurotoxins in dopaminergic cells.
24784582 2014 Ubiquitin is phosphorylated by PINK1 to activate parkin.
24751806 2014 Loss of PINK1 impairs stress-induced autophagy and cell survival.
24751536 2014 PINK1 phosphorylates ubiquitin to activate Parkin E3 ubiquitin ligase activity.
24743735 2014 Mitochondrial proteolytic stress induced by loss of mortalin function is rescued by Parkin and PINK1.
24681957 2015 The Parkinson's gene PINK1 regulates cell cycle progression and promotes cancer-associated phenotypes.
24677602 2014 Genetic mutations in early-onset Parkinson's disease Mexican patients: molecular testing implications.
24660806 2014 Parkin is activated by PINK1-dependent phosphorylation of ubiquitin at Ser65.
24626860 2014 Quantitative phosphoproteomic profiling of PINK1-deficient cells identifies phosphorylation changes in nuclear proteins.
24553947 2014 Loss of PINK1 attenuates HIF-1? induction by preventing 4E-BP1-dependent switch in protein translation under hypoxia.
24522549 2014 Oxidative stress-induced signaling pathways implicated in the pathogenesis of Parkinson's disease.
24475098 2014 BAG5 protects against mitochondrial oxidative damage through regulating PINK1 degradation.
24446486 2014 Parkin and PINK1 function in a vesicular trafficking pathway regulating mitochondrial quality control.
24385196 2014 PINK1 and its familial Parkinson's disease-associated mutation regulate brain vascular endothelial inflammation.
24383081 2013 The BAG2 protein stabilises PINK1 by decreasing its ubiquitination.
24374372 2014 Mutant PINK1 upregulates tyrosine hydroxylase and dopamine levels, leading to vulnerability of dopaminergic neurons.
24357652 2014 Cytosolic cleaved PINK1 represses Parkin translocation to mitochondria and mitophagy.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
24189060 2013 A dimeric PINK1-containing complex on depolarized mitochondria stimulates Parkin recruitment.
24184327 2014 Mitochondrial impairment increases FL-PINK1 levels by calcium-dependent gene expression.
24151868 2014 Beyond the mitochondrion: cytosolic PINK1 remodels dendrites through protein kinase A.
24149988 2013 The accumulation of misfolded proteins in the mitochondrial matrix is sensed by PINK1 to induce PARK2/Parkin-mediated mitophagy of polarized mitochondria.
24149440 2013 The TOMM machinery is a molecular switch in PINK1 and PARK2/PARKIN-dependent mitochondrial clearance.
24128678 2013 Altered expression of DJ-1 and PINK1 in sporadic ALS and in the SOD1(G93A) ALS mouse model.
24121706 2013 PINK1 is degraded through the N-end rule pathway.
23986421 Incidence of mutations in the PARK2, PINK1, PARK7 genes in Polish early-onset Parkinson disease patients.
23933751 2013 The Parkinson's disease-linked proteins Fbxo7 and Parkin interact to mediate mitophagy.
23885119 2013 SARM1 and TRAF6 bind to and stabilize PINK1 on depolarized mitochondria.
23754282 2013 Parkin-catalyzed ubiquitin-ester transfer is triggered by PINK1-dependent phosphorylation.
23751051 2013 The principal PINK1 and Parkin cellular events triggered in response to dissipation of mitochondrial membrane potential occur in primary neurons.
23626584 2013 Structure and Function of Parkin, PINK1, and DJ-1, the Three Musketeers of Neuroprotection.
23620051 2013 PINK1-phosphorylated mitofusin 2 is a Parkin receptor for culling damaged mitochondria.
23533695 2013 Function and characteristics of PINK1 in mitochondria.
23525905 2013 TRAP1 rescues PINK1 loss-of-function phenotypes.
23519076 2013 PINK1 protects against cell death induced by mitochondrial depolarization, by phosphorylating Bcl-xL and impairing its pro-apoptotic cleavage.
23472196 2013 Tom70 is essential for PINK1 import into mitochondria.
23459931 2013 PINK1 rendered temperature sensitive by disease-associated and engineered mutations.
23393160 2013 AF-6 is a positive modulator of the PINK1/parkin pathway and is deficient in Parkinson's disease.
23319602 2013 PINK1 drives Parkin self-association and HECT-like E3 activity upstream of mitochondrial binding.
23303188 2013 Characterization of PINK1 (PTEN-induced putative kinase 1) mutations associated with Parkinson disease in mammalian cells and Drosophila.
23261939 2013 Increase of oxidative stress by a novel PINK1 mutation, P209A.
23256036 2012 PINK1-mediated phosphorylation of the Parkin ubiquitin-like domain primes mitochondrial translocation of Parkin and regulates mitophagy.
23251494 2012 The bioenergetic status relates to dopamine neuron loss in familial PD with PINK1 mutations.
23212910 2013 Phosphatase and tensin homolog (PTEN)-induced putative kinase 1 (PINK1)-dependent ubiquitination of endogenous Parkin attenuates mitophagy: study in human primary fibroblasts and induced pluripotent stem cell-derived neurons.
22956510 2012 Systematic review and UK-based study of PARK2 (parkin), PINK1, PARK7 (DJ-1) and LRRK2 in early-onset Parkinson's disease.
22910362 2012 PINK1 autophosphorylation upon membrane potential dissipation is essential for Parkin recruitment to damaged mitochondria.
22764206 2012 Pharmacological rescue of mitochondrial deficits in iPSC-derived neural cells from patients with familial Parkinson's disease.
22724072 2012 PINK1 is activated by mitochondrial membrane potential depolarization and stimulates Parkin E3 ligase activity by phosphorylating Serine 65.
22643835 2012 PINK1 stimulates interleukin-1?-mediated inflammatory signaling via the positive regulation of TRAF6 and TAK1.
22547060 2012 Pink1 kinase and its membrane potential (Delta?)-dependent cleavage product both localize to outer mitochondrial membrane by unique targeting mode.
22486164 2012 Kinase signaling dysfunction in Parkinson's disease: a reverse genetic approach in Drosophila.
22445250 2012 Analysis of LRRK2, SNCA, Parkin, PINK1, and DJ-1 in Zambian patients with Parkinson's disease.
22434215 2012 Compensatory premotor activity during affective face processing in subclinical carriers of a single mutant Parkin allele.
22354088 2012 Mitochondrial processing peptidase regulates PINK1 processing, import and Parkin recruitment.
22238344 2012 Microtubule affinity-regulating kinase 2 (MARK2) turns on phosphatase and tensin homolog (PTEN)-induced kinase 1 (PINK1) at Thr-313, a mutation site in Parkinson disease: effects on mitochondrial transport.
22233331 2012 Genetic bases and phenotypes of autosomal recessive Parkinson disease in a Turkish population.
22212487 2012 PINK1 overexpression protects against C2-ceramide-induced CAD cell death through the PI3K/AKT pathway.
22078885 2011 PINK1 and Parkin target Miro for phosphorylation and degradation to arrest mitochondrial motility.
22076283 2012 Partial sensitization of human bladder cancer cells to a gene-therapeutic adenovirus carrying REIC/Dkk-3 by downregulation of BRPK/PINK1.
22057787 2012 Parkin, PINK1 and mitochondrial integrity: emerging concepts of mitochondrial dysfunction in Parkinson's disease.
22048964 2012 Combined expression of BUB1B, DLGAP5, and PINK1 as predictors of poor outcome in adrenocortical tumors: validation in a Brazilian cohort of adult and pediatric patients.
22043288 2011 Bioenergetic consequences of PINK1 mutations in Parkinson disease.
21925922 2012 Mutation analysis of the PINK1 gene in Southern Italian patients with early- and late-onset parkinsonism.
21784538 2011 Genetic mutations and functions of PINK1.
21743139 2011 Mutation analysis of PINK1 gene in patients with early-onset Parkinsonism.
21677397 2011 Variation in the PTEN-induced putative kinase 1 gene associated with the increase risk of type 2 diabetes in northern Chinese.
21606348 2011 PTEN-inducible kinase 1 (PINK1)/Park6 is indispensable for normal heart function.
21563316 2012 Synaptic vesicle trafficking and Parkinson's disease.
21508222 2011 Mitochondrial Parkin recruitment is impaired in neurons derived from mutant PINK1 induced pluripotent stem cells.
21426348 2011 The mitochondrial intramembrane protease PARL cleaves human Pink1 to regulate Pink1 trafficking.
21412950 2011 Phylogenetic and in silico structural analysis of the Parkinson disease-related kinase PINK1.
21408142 2011 Mutations in PINK1 and Parkin impair ubiquitination of Mitofusins in human fibroblasts.
21366594 2011 Impairment of oxidative stress-induced heme oxygenase-1 expression by the defect of Parkinson-related gene of PINK1.
21355049 2011 Functional alteration of PARL contributes to mitochondrial dysregulation in Parkinson's disease.
21322020 2011 PRKN, DJ-1, and PINK1 screening identifies novel splice site mutation in PRKN and two novel DJ-1 mutations.
21242281 2011 Parallel high-throughput RNA interference screens identify PINK1 as a potential therapeutic target for the treatment of DNA mismatch repair-deficient cancers.
21187721 2011 Regulation of PINK1-Parkin-mediated mitophagy.
21177249 2011 A new cytosolic pathway from a Parkinson disease-associated kinase, BRPK/PINK1: activation of AKT via mTORC2.
21145388 2011 Association of Parkinson disease-related protein PINK1 with Alzheimer disease and multiple sclerosis brain lesions.
21138942 2011 PINK1 cleavage at position A103 by the mitochondrial protease PARL.
20971498 2011 PINK1 displays tissue-specific subcellular location and regulates apoptosis and cell growth in breast cancer cells.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20871098 2010 Mitofusin 1 and mitofusin 2 are ubiquitinated in a PINK1/parkin-dependent manner upon induction of mitophagy.
20842103 2010 Inhibition of mitochondrial fusion by ?-synuclein is rescued by PINK1, Parkin and DJ-1.
20798600 2010 The PINK1/Parkin-mediated mitophagy is compromised by PD-associated mutations.
20637729 2010 Oxidative stress alters the regulatory control of p66Shc and Akt in PINK1 deficient cells.
20558144 2010 Assessing the prevalence of PINK1 genetic variants in South African patients diagnosed with early- and late-onset Parkinson's disease.
20547144 2010 R492X mutation in PTEN-induced putative kinase 1 induced cellular mitochondrial dysfunction and oxidative stress.
20513816 2010 Progression of subtle motor signs in PINK1 mutation carriers with mild dopaminergic deficit.
20508036 2010 Effect of endogenous mutant and wild-type PINK1 on Parkin in fibroblasts from Parkinson disease patients.
20506312 2010 Genetic etiology of Parkinson disease associated with mutations in the SNCA, PARK2, PINK1, PARK7, and LRRK2 genes: a mutation update.
20483373 2010 Structural imaging in the presymptomatic stage of genetically determined parkinsonism.
20461815 2010 Clinical and demographic characteristics of PINK1 mutation carriers--a meta-analysis.
20404107 2010 PINK1 stabilized by mitochondrial depolarization recruits Parkin to damaged mitochondria and activates latent Parkin for mitophagy.
20399249 2010 Mutation analysis of parkin and PINK1 genes in early-onset Parkinson's disease in China.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20376796 2010 [Establishment and application of an analytical method for PINK1 gene exon copy number].
20356854 2010 PINK1-linked parkinsonism is associated with Lewy body pathology.
20179104 2010 Decreased expression of Drp1 and Fis1 mediates mitochondrial elongation in senescent cells and enhances resistance to oxidative stress through PINK1.
20171192 2010 Formation of parkin aggregates and enhanced PINK1 accumulation during the pathogenesis of Parkinson's disease.
20164189 2010 Perturbations in mitochondrial dynamics induced by human mutant PINK1 can be rescued by the mitochondrial division inhibitor mdivi-1.
20153330 2010 PINK1 is recruited to mitochondria with parkin and associates with LC3 in mitophagy.
20146068 2010 Mutation analysis of Parkin, PINK1 and DJ-1 genes in Chinese patients with sporadic early onset parkinsonism.
20098416 2010 PINK1/Parkin-mediated mitophagy is dependent on VDAC1 and p62/SQSTM1.
20045449 2010 Enhanced vulnerability of PARK6 patient skin fibroblasts to apoptosis induced by proteasomal stress.
20034704 2011 Mutational analysis of parkin and PINK1 in multiple system atrophy.
20012177 2009 Mitochondrial quality control: insights on how Parkinson's disease related genes PINK1, parkin, and Omi/HtrA2 interact to maintain mitochondrial homeostasis.
19966284 2010 PINK1-dependent recruitment of Parkin to mitochondria in mitophagy.
19944740 2010 PINK1 polymorphism IVS1-7 A-->G, exposure to environmental risk factors and anticipation of disease onset in Brazilian patients with early-onset Parkinson's Disease.
19904588 2009 Mitochondrial respiratory dysfunction and mutations in mitochondrial DNA in PINK1 familial parkinsonism.
19890973 2009 Olfactory dysfunction in Parkinsonism caused by PINK1 mutations.
19889566 2010 Evaluation of PINK1 variants in Indian Parkinson's disease patients.
19880420 2010 Phosphorylation of parkin by Parkinson disease-linked kinase PINK1 activates parkin E3 ligase function and NF-kappaB signaling.
19847793 2009 Clinically reported heterozygous mutations in the PINK1 kinase domain exert a gene dosage effect.
19822161 2010 Responsiveness to distracting stimuli, though increased in Parkinson's disease, is decreased in asymptomatic PINK1 and Parkin mutation carriers.
19726410 2010 A comparative study of LRRK2, PINK1 and genetically undefined familial Parkinson's disease.
19692353 2009 Leucine-Rich Repeat Kinase 2 interacts with Parkin, DJ-1 and PINK-1 in a Drosophila melanogaster model of Parkinson's disease.
19562775 2009 PINK1 mutations in a Brazilian cohort of early-onset Parkinson's disease patients.
19500570 2009 Differential effects of PINK1 nonsense and missense mutations on mitochondrial function and morphology.
19492085 2009 Mitochondrial alterations in PINK1 deficient cells are influenced by calcineurin-dependent dephosphorylation of dynamin-related protein 1.
19405094 2009 Relative contribution of simple mutations vs. copy number variations in five Parkinson disease genes in the Belgian population.
19358826 2009 Parkin stabilizes PINK1 through direct interaction.
19351622 2009 Parkin and PINK1 mutations in early-onset Parkinson's disease: comprehensive screening in publicly available cases and control.
19330279 2009 Different saccadic abnormalities in PINK1 mutation carriers and in patients with non-genetic Parkinson's disease.
19285945 2009 PINK1-associated Parkinson's disease is caused by neuronal vulnerability to calcium-induced cell death.
19279012 2009 Loss of PINK1 function promotes mitophagy through effects on oxidative stress and mitochondrial fission.
19276113 2009 FOXO3a-dependent regulation of Pink1 (Park6) mediates survival signaling in response to cytokine deprivation.
19270741 2009 Silencing of PINK1 expression affects mitochondrial DNA and oxidative phosphorylation in dopaminergic cells.
19242547 2009 PINK1 defect causes mitochondrial dysfunction, proteasomal deficit and alpha-synuclein aggregation in cell culture models of Parkinson's disease.
19229105 2009 Parkin, PINK1, and DJ-1 form a ubiquitin E3 ligase complex promoting unfolded protein degradation.
19224617 2009 Do polymorphisms in the familial Parkinsonism genes contribute to risk for sporadic Parkinson's disease?
19214605 2009 A new complex homozygous large rearrangement of the PINK1 gene in a Sudanese family with early onset Parkinson's disease.
19205068 2009 Familial Parkinsonism and early onset Parkinson's disease in a Brazilian movement disorders clinic: phenotypic characterization and frequency of SNCA, PRKN, PINK1, and LRRK2 mutations.
19167501 2009 Molecular interaction between parkin and PINK1 in mammalian neuronal cells.
19152501 2009 Pink1 forms a multiprotein complex with Miro and Milton, linking Pink1 function to mitochondrial trafficking.
19139432 2009 Gene expression profiling reveals a new classification of adrenocortical tumors and identifies molecular predictors of malignancy and survival.
19087301 2008 Significance of the parkin and PINK1 gene in Jordanian families with incidences of young-onset and juvenile parkinsonism.
19076428 2008 What have PINK1 and HtrA2 genes told us about the role of mitochondria in Parkinson's disease?
19048950 2008 [Case of a 30-year history of PARK6 --findings from functional imaging of the brain].
19038850 2009 Heterozygous carriers of a Parkin or PINK1 mutation share a common functional endophenotype.
19006224 2009 Genotype-phenotype correlates in Taiwanese patients with early-onset recessive Parkinsonism.
18973254 2009 Genotypic and phenotypic characteristics of Dutch patients with early onset Parkinson's disease.
18957282 2008 PINK1 controls mitochondrial localization of Parkin through direct phosphorylation.
18785233 2008 Mutation analysis of Parkin, PINK1, DJ-1 and ATP13A2 genes in Chinese patients with autosomal recessive early-onset Parkinsonism.
18704525 2008 Analysis of PARK genes in a Korean cohort of early-onset Parkinson disease.
18687899 2008 The kinase domain of mitochondrial PINK1 faces the cytoplasm.
18685134 2008 PINK1 mutations and parkinsonism.
18584234 2008 Subclinical sensory abnormalities in unaffected PINK1 heterozygotes.
18560593 2008 PINK1 is necessary for long term survival and mitochondrial function in human dopaminergic neurons.
18546294 2008 Familial Parkinsonism with digenic parkin and PINK1 mutations.
18541801 2008 Mutation analysis of the PINK1 gene in 391 patients with Parkinson disease.
18524835 2008 Coexistence of mutations in PINK1 and mitochondrial DNA in early onset parkinsonism.
18495756 2008 Genomic variants at the PINK1 locus are associated with transcript abundance and plasma nonesterified fatty acid concentrations in European whites.
18486522 2009 Screening PARK genes for mutations in early-onset Parkinson's disease patients from Queensland, Australia.
18469032 2008 Transcranial sonography findings in a large family with homozygous and heterozygous PINK1 mutations.
18397367 2008 Characterization of PINK1 processing, stability, and subcellular localization.
18378882 2008 Bilateral subthalamic stimulation in Parkin and PINK1 parkinsonism.
18359116 2008 L347P PINK1 mutant that fails to bind to Hsp90/Cdc37 chaperones is rapidly degraded in a proteasome-dependent manner.
18330912 2008 PINK1 heterozygous rare variants: prevalence, significance and phenotypic spectrum.
18307263 2008 Late onset sporadic Parkinson's disease caused by PINK1 mutations: clinical and functional study.
18286320 2008 Clinical and molecular characterisation of a Parkinson family with a novel PINK1 mutation.
18272063 2008 [A little bit of PINK in Parkinson's disease].
18261714 2008 Limbic and frontal cortical degeneration is associated with psychiatric symptoms in PINK1 mutation carriers.
18221368 2008 Biochemical aspects of the neuroprotective mechanism of PTEN-induced kinase-1 (PINK1).
18211709 2008 Analysis of Parkinson disease patients from Portugal for mutations in SNCA, PRKN, PINK1 and LRRK2.
18068301 2008 Mutation analysis of the parkin and PINK1 genes in American Caucasian early-onset Parkinson disease families.
18031932 2008 Cytoplasmic localization and proteasomal degradation of N-terminally cleaved form of PINK1.
18003639 2008 Pink1 Parkinson mutations, the Cdc37/Hsp90 chaperones and Parkin all influence the maturation or subcellular distribution of Pink1.
17989306 2007 Loss-of-function of human PINK1 results in mitochondrial pathology and can be rescued by parkin.
17960343 2007 PINK1 mutation in Taiwanese early-onset parkinsonism : clinical, genetic, and dopamine transporter studies.
17950257 2007 Expression of PINK1 mRNA in human and rodent brain and in Parkinson's disease.
17766179 2008 Sleep quality in a family with hereditary parkinsonism (PARK6).
17724286 2007 Morphometric fingerprint of asymptomatic Parkin and PINK1 mutation carriers in the basal ganglia.
17707122 2007 PINK1 mutants associated with recessive Parkinson's disease are defective in inhibiting mitochondrial release of cytochrome c.
17579517 2007 PINK1 protects against oxidative stress by phosphorylating mitochondrial chaperone TRAP1.
17567565 2007 Altered regulation of the PINK1 locus: a link between type 2 diabetes and neurodegeneration?
17557243 2007 [PINK1 IVS5-5 G>A polymorphism may contribute to the risk of late onset Parkinson disease in Chinese].
17362513 2007 The human PINK1 locus is regulated in vivo by a non-coding natural antisense RNA during modulation of mitochondrial function.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17219214 2007 Biological effects of the PINK1 c.1366C>T mutation: implications in Parkinson disease pathogenesis.
17202228 2007 Co-occurrence of affective and schizophrenia spectrum disorders with PINK1 mutations.
17172567 2007 PINK1 mutation heterozygosity and the risk of Parkinson's disease.
17154281 2007 Whole gene deletion and splicing mutations expand the PINK1 genotypic spectrum.
17141510 2007 Mitochondrial dysfunction, peroxidation damage and changes in glutathione metabolism in PARK6.
17084972 2006 A common A340T variant in PINK1 gene associated with late-onset Parkinson's disease in Chinese.
17055324 2007 Novel features in a patient homozygous for the L347P mutation in the PINK1 gene.
17030667 2006 T313M PINK1 mutation in an extended highly consanguineous Saudi family with early-onset Parkinson disease.
17017532 2006 PINK-1 and DJ-1--new genes for autosomal recessive Parkinson's disease.
17013904 2007 Phenotypic spectrum of PINK1-associated parkinsonism in 15 mutation carriers from 1 family.
17000703 2006 C-terminal truncation and Parkinson's disease-associated mutations down-regulate the protein serine/threonine kinase activity of PTEN-induced kinase-1.
16969854 2006 A heterozygous effect for PINK1 mutations in Parkinson's disease?
16966503 2006 Juvenile-onset Parkinsonism as a result of the first mutation in the adenosine triphosphate orientation domain of PINK1.
16805805 2006 Altered cleavage and localization of PINK1 to aggresomes in the presence of proteasomal stress.
16769864 2006 Clinical spectrum of homozygous and heterozygous PINK1 mutations in a large German family with Parkinson disease: role of a single hit?
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16702191 2006 PINK1 protein in normal human brain and Parkinson's disease.
16700027 2006 PINK1 homozygous W437X mutation in a patient with apparent dominant transmission of parkinsonism.
16672981 2006 Drosophila pink1 is required for mitochondrial function and interacts genetically with parkin.
16632486 2006 Association of PINK1 and DJ-1 confers digenic inheritance of early-onset Parkinson's disease.
16547921 2006 Homozygous and heterozygous PINK1 mutations: considerations for diagnosis and care of Parkinson's disease patients.
16482571 2006 PINK1 mutations in sporadic early-onset Parkinson's disease.
16401616 2006 Mutational analysis of the PINK1 gene in early-onset parkinsonism in Europe and North Africa.
16354302 2005 Exclusion of PINK1 as candidate gene for the late-onset form of Parkinson's disease in two European populations.
16257123 2006 Analysis of the PINK1 gene in a cohort of patients with sporadic early-onset parkinsonism in Taiwan.
16226715 2005 Small interfering RNA targeting the PINK1 induces apoptosis in dopaminergic cells SH-SY5Y.
16207731 2005 Mitochondrial import and enzymatic activity of PINK1 mutants associated to recessive parkinsonism.
16207217 2005 Analysis of PINK1 in Asian patients with familial parkinsonism.
16157901 2005 LRRK2 gene in Parkinson disease: mutation analysis and case control association study.
16079129 2005 Wild-type PINK1 prevents basal and induced neuronal apoptosis, a protective effect abrogated by Parkinson disease-related mutations.
16046032 2006 Assessment of PINK1 (PARK6) polymorphisms in Finnish PD.
16009891 2005 Early-onset parkinsonism associated with PINK1 mutations: frequency, genotypes, and phenotypes.
15970950 2005 PINK1, Parkin, and DJ-1 mutations in Italian patients with early-onset parkinsonism.
15955954 2005 The PINK1 phenotype can be indistinguishable from idiopathic Parkinson disease.
15955953 2005 Clinicogenetic study of PINK1 mutations in autosomal recessive early-onset parkinsonism.
15876334 2005 G309D and W437OPA PINK1 mutations in Caucasian Parkinson's disease patients.
15824318 2005 Mutations in PTEN-induced putative kinase 1 associated with recessive parkinsonism have differential effects on protein stability.
15596610 2004 Analysis of the PINK1 gene in a large cohort of cases with Parkinson disease.
15542245 2004 Genetic association study of PINK1 coding polymorphisms in Parkinson's disease.
15505171 2004 PINK1 (PARK6) associated Parkinson disease in Ireland.
15505170 2004 PARK6-linked autosomal recessive early-onset parkinsonism in Asian populations.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15349870 2004 Novel PINK1 mutations in early-onset parkinsonism.
15349860 2004 PINK1 mutations are associated with sporadic early-onset parkinsonism.
15349859 2004 The gene responsible for PARK6 Parkinson's disease, PINK1, does not influence common forms of parkinsonism.
15087508 2004 Hereditary early-onset Parkinson's disease caused by mutations in PINK1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14607334 2003 BRPK, a novel protein kinase showing increased expression in mouse cancer cell lines with higher metastatic potential.
12548371 2002 PARK6 is a common cause of familial parkinsonism.
12548343 2002 Autosomal recessive early onset parkinsonism is linked to three loci: PARK2, PARK6, and PARK7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12447943 2002 Clinical and subclinical dopaminergic dysfunction in PARK6-linked parkinsonism: an 18F-dopa PET study.
11494141 2001 Growth-suppressive effects of BPOZ and EGR2, two genes involved in the PTEN signaling pathway.
11254447 2001 Localization of a novel locus for autosomal recessive early-onset parkinsonism, PARK6, on human chromosome 1p35-p36.