Property Summary

NCBI Gene PubMed Count 2
PubMed Score 515.27
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

AA Sequence

MADEEKLPPGWEKRMSRPSGRGYYFNHITNPSQWERPSGNSSSGGKIWQGEPARVRRSHLLVKPVKAALD      1 - 70
LAAGNHPDQGGGPGADQRLHPEDQGRREGL                                             71 - 100
//

Text Mined References (3)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
9299231 1997 The human PIN1 peptidyl-prolyl cis/trans isomerase gene maps to human chromosome 19p13 and the closely related PIN1L gene to 1p31.