Property Summary

Ligand Count 69
NCBI Gene PubMed Count 333
PubMed Score 522.83
PubTator Score 562.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.800 1.1e-05
astrocytic glioma -1.400 8.7e-03
Astrocytoma, Pilocytic -1.400 1.7e-06
atypical teratoid / rhabdoid tumor -1.900 1.9e-09
ependymoma -1.500 5.2e-13
glioblastoma -1.300 2.5e-08
group 4 medulloblastoma -1.400 1.2e-04
medulloblastoma, large-cell -1.700 6.2e-06
ovarian cancer 1.100 1.3e-03
primitive neuroectodermal tumor -1.400 5.2e-04

 GWAS Trait (1)

Protein-protein Interaction (10)

PDB (76)

Gene RIF (303)

AA Sequence

MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRP      1 - 70
SSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFA     71 - 140
LRTGEMSGPVFTDSGIHIILRTE                                                   141 - 163
//

Text Mined References (341)

PMID Year Title