Property Summary

NCBI Gene PubMed Count 303
PubMed Score 515.27
PubTator Score 562.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.400 8.7e-03
ependymoma -1.500 5.2e-13
glioblastoma -1.600 2.5e-06
medulloblastoma -1.400 3.0e-06
atypical teratoid / rhabdoid tumor -1.900 1.9e-09
medulloblastoma, large-cell -1.700 6.2e-06
primitive neuroectodermal tumor -1.400 5.2e-04
adult high grade glioma -1.800 1.1e-05
pilocytic astrocytoma -1.400 1.3e-06
ovarian cancer 1.100 1.3e-03

Synonym

Accession Q13526 A8K4V9 Q53X75
Symbols DOD
UBL5

Gene

PANTHER Protein Class (1)

PDB

1F8A   1I6C   1I8G   1I8H   1NMV   1NMW   1PIN   1ZCN   2F21   2ITK   2KBU   2KCF   2LB3   2M8I   2M8J   2M9E   2M9F   2M9I   2M9J   2N1O   2Q5A   2RUC   2RUD   2RUQ   2RUR   2XP3   2XP4   2XP5   2XP6   2XP7   2XP8   2XP9   2XPA   2XPB   2ZQS   2ZQT   2ZQU   2ZQV   2ZR4   2ZR5   2ZR6   3I6C   3IK8   3IKD   3IKG   3JYJ   3KAB   3KAC   3KAD   3KAF   3KAG   3KAH   3KAI   3KCE   3NTP   3ODK   3OOB   3TC5   3TCZ   3TDB   3WH0   4GWT   4GWV   4QIB   4TNS   4TYO   4U84   4U85   4U86  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Protein-protein Interaction (3)

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
504536 confirmatory 20 / 131 / 1123 qHTS Validation Assay to Find Inhibitors of Pin1
504591 summary 0 / 0 / 0 Pin1 inhibitors: Summary
504891 confirmatory 34 / 22628 / 364905 qHTS Assay to Find Inhibitors of Pin1
624308 confirmatory 8 / 4 / 4 qHTS Assay to Find Inhibitors of Pin1: Hit Validation
624312 confirmatory 6 / 5 / 5 qHTS Assay to Find Inhibitors of Pin1: Hit Validation using Tamra Binding

Gene RIF (275)

PMID Text
26977025 The expression of PIN1 was associated with risk of malignancy, tumour location, tumour size, and mitotic counts in gastrointestinal stromal tumors.
26917410 Results indicate that PIN1 may be a valuable target to hit in cancer cells characterized by increased aggressive potential, overexpression of erbB receptor family members, and defective p53.
26874277 This shows that Pin1 is implemented in maintaining the susceptibility to the genotoxic drugs by controlling P-gp level as well as p53-dependent apoptosis and cell cycle signaling pathways.
26784107 Report shows that PIN1 binds to and stabilizes HIF-1alpha, consequently enhancing the angiogenesis.
26752745 Data show that Prolyl isomerase Pin1 is expressed in an epidermal growth factor receptor (EGFR)-mutant lung cancer tissue that has undergone partial epithelial-mesenchymal transition (EMT) and acquired resistance to EGFR tyrosine kinase inhibitors (TKIs).
26651388 the role of hydration in the structural integrity of Pin1
26461058 Pin1 knockdown in HCC cells inhibited the phosphorylation of NF-kappaB-p65(Ser276).
26456073 Structural Analysis of the Pin1-CPEB1 interaction and its potential role in CPEB1 degradation has been described.
26406962 The binding affinities of series of 4-substituted proline derivatives of phosphopeptides to the WW domain of Pin1 were investigated.
26387736 Results show that Pin1 down-regulates the mitochondrial activity of ATR through its isomerization from cis- to trans-isomers.
26381174 Expression of Pin1 was decreased at or above the Cd IC50 value and was inversely correlated with the level of phospho-Ser-GSK3alphabeta in oral squamous cell carcinoma.
26276391 Pin1 plays an important role in the pathogenic mechanisms underlying impaired glucose and lipid metabolism, functioning as a negative regulator of AMPK
26236013 Activation of BAX through the concerted action of cytosolic p53 and Pin1 may integrate cell stress signals to induce a direct apoptotic response.
26226559 Allosteric Breakage of the Hydrogen Bond within the Dual-Histidine Motif in the Active Site of Human Pin1 PPIase
26150353 miR-140-5p regulated Pin1 expression at the translational level via directly targeting its 3'UTR. Our results collectively demonstrate that Pin1 acts as an important regulator of TSPC aging
26133706 Peptidyl-Prolyl cis/trans Isomerase NIMA-Interacting 1 as a Therapeutic Target in Hepatocellular Carcinoma
26039047 These findings suggest the potential effectiveness of Pin1 inhibitors as therapeutic agents for prostate cancers, regardless of their androgen sensitivity.
25921067 Data indicate that separase is subject to native-state cis/trans isomerization by peptidyl-prolyl-isomerase Pin1.
25913034 Evidence indicates that Pin1 regulates several key steps of HIV-1 life cycle and potentially promotes its infection by activating multiple oncogenes and inactivating multiple tumor suppressors, extending the life span of HIV-infected cells. [review]
25866209 Pin1 has a role in allosteric regulation of ERalpha function
25849135 ATRA simultaneously blocks multiple Pin1-regulated pathways in acute promyelocytic leukemia and breast cancer
25837727 The roles of the three tryptophan residues (W11, W34 and W73)in maintaining the structure and the function of Pin1
25818297 Pin1/Rab2A/Erk drives BCSC expansion and tumorigenicity, suggesting potential drug targets.
25766872 Pin1 has an intricate relationship with the regulatory protein kinase and phosphoproteomic networks that orchestrate complex cellular processes and respond to environmental cues.
25742740 the functional involvement of the Pin1-E2F1 axis in the anti-proliferative effect of BZB indicating Pin1-E2F as an attractive target to control HCC cell growth.
25675300 results indicate that Pin1 has a critical role in the modulation of Rb function by the regulation of Rb dephosphorylation, which may have an important pathological role in cancer development.
25667458 PIN1-mediated SGK1 ubiquitination is a major regulator of tamoxifen-resistant breast cancer cell growth and survival
25662955 Pin1 may be thought of as a molecular timer which modulates cell cycle progression networks.
25623232 ZBP-89 attenuates HDAC3 by increasing IkappaB degradation, dependent on Pin1 but independent of NF-Kappab
25588053 These data suggest that prolinedirected phosphorylation regulates Kaposi's sarcoma-associated herpesvirus Rta by licensing binding to Pin1.
25583562 Pin1 is down-regulated or inactivated by multiple mechanisms in AD brains.
25576397 Results not only identify a novel Pin1 oxidation site to be the critical catalytic residue Cys113, but also provide a novel oxidative regulation mechanism for inhibiting Pin1 activity in Alzheimer's disease.
25553719 Pin1 is a promising diagnostic biomarker as well as an efficient therapeutic target for breast cancer
25543254 Based on extensive molecular dynamics simulations, an atomistic picture of the pathways mediating the allosteric regulation of the PPIase domain of Pin1 by its WW domain is presented here.
25512367 This study is the first to demonstrate that PIN1 inhibition exhibits anti-inflammatory effects and blocks osteoclastic differentiation in LPS- and nicotine-treated human periodontal ligament cells
25463757 Pin1 regulates the osteogenic activity of Osterix.
25335736 We found -667TT heterozygotes of the PIN1 gene had a significantly increased risk of oral squamous cell carcinoma
25280783 Pin1 is overexpressed in gastric cancer and correlates with clinicopathologic features.
25182609 The review discuss the role of pin-1 in pathogenesis of many disease as its inactivation is associated with Alzheimer disease.
25174754 Pin1 is overexpressed in several human cancers and contributes to tumorigenesis. Its inactivation constitutes a promising therapeutic strategy. [review]
25170559 Serum Pin1 level can be used as a potential independent marker for the presence of nonalcoholic steatohepatitis and advanced fibrotic scores.
25160749 Pin1 upregulation was associated with advanced stage and poor prognosis of ESCC.
25100325 This work demonstrated that residue C113 in human Pin1 plays a role in keeping the catalytic site in an active fold.
25036886 Phosphorylation of HIV-1 CA at serine residue 16 is involved in the HIV-1 core uncoating process. Interaction of PIN1 with the CA core within the target cells is required for the uncoating process
25031083 The role of pH in Pin1, was investigated.
24964035 We report on a colocalization of phosphorylated Smad in AD with Pin1. data suggest both Smad proteins and Pin1 to be elements of a vicious circle with potential pathogenetic significance in Alzheimer's disease.
24915000 These results support miR-296-5p playing a tumor-suppressive role by targeting Pin1.
24840168 Data suggest Cys113 protonation state mediates dynamic hydrogen-bonding in active site of PIN1 (un-protonated in free Pin1; neutral in substrate-bound Pin1); this involves two histidines and other residues, highly conserved/necessary for catalysis.
24786790 Pin1 is a pivotal regulator acting downstream of miR200c to drive Breast cancer stem-like cells and breast tumorigenicity, highlighting a new therapeutic target to eradicate Breast cancer stem-like cells.
24715170 Pin1 regulates the activation of Wnt/beta-catenin pathway in squamous cell carcinoma via modulating the interaction between beta-catenin and APC.
24530597 Pin1 induction during liver fibrosis is involved in hepatic stellate cell activation, TGFbeta1 expression, and TGFbeta1-mediated fibrogenesis signalling.
24509437 Authors showed that virion-associated extracellular signal-regulated kinase 2 (ERK2) phosphorylates HIV-1 capsid protein at serine 16, that is required for the Pin1-dependent HIV-1 uncoating.
24439903 Chlamydia trachomatis replication depends on a subset of altered proteins, such as Pin1 and Men1, that regulate the host transcription factor AP-1 controlling host inflammation, stress, and cell survival.
24416409 The prolyl isomerase pin1 regulates mRNA levels of genes with short half-lives by targeting specific RNA binding proteins, such as HuR and AUF1.
24357640 The interaction with Pin1, Notch1 and Notch4, key regulators of cell fate, escape from proteasomal degradation by their major ubiquitin-ligase Fbxw7alpha.
24311591 Molecular-dynamics simulations starting from the structure of the Pin1 WW domain suggest that the crystal structure closely resembles the conformation of this domain in solution.
24289610 Pin1 promoter rs2233678 and rs2233679 polymorphisms is associated with cancer.
24265246 COT interacts with and phosphorylates Pin1 on Ser16. Consequently, Pin1 Ser16 phosphorylation by COT increases cyclin D1 abundance and enhances tumorigenecity of MCF7 cells.
24219242 PIN1 acts as an important modulator of odontogenic and adipogenic differentiation of human dental pulp stem cells
24145406 Autophosphorylation and Pin1 binding coordinate DNA damage-induced HIPK2 activation and cell death.
24126052 PIN1 acts as a stress sensor regulating HSF1 activity in response to stress on multiple levels through the transcriptional activation of stress response elements.
24116866 a simple twisted amide transition state is the mechanism for peptidyl prolyl isomerization catalyzed by Pin1.
24100296 Identify a novel form of histone H1 regulation through phosphorylation-dependent pin1 mediated proline isomerization, which has consequences on overall H1 phosphorylation levels and the stability of H1 binding to chromatin.
24072701 miRNA-200b regulates the activity of PEA3 and ELK-1 via the Pin1-pERK pathway and forms self-regulated feedback loops.
24021617 Pin1 may be a promising early-diagnostic biomarker as well as an effective therapeutic drug for the early-diagnosis, prevention, and treatment of essential hypertension.
24013949 The PIN1 -842G/C polymorphism is associated with a significantly reduced risk of cancer, especially in Asian populations. [Meta-analysis]
24001231 Phosphorylation of HIV-1 CA at serine residue 16 is involved in the HIV-1 core uncoating process. Interaction of PIN1 with the CA core within the target cells is required for the uncoating process
23994618 RAF-1 phosphorylation and PIN1 isomerization together regulate KLF10 stability and further affect the role of KLF10 in tumor progression.
23990466 SEPT9 plays multiple roles in abscission, one of which is regulated by the action of Cdk1 and Pin1.
23982872 PIN1 rs2233678 polymorphism might be a potential biomarker for cancer risk among Asians, especially for breast cancer.
23980573 results from molecular dynamics studies show dynamics of Pin1 and the enzyme-substrate interactions are intricately coupled to isomerization during catalysis; strength of interactions between phosphate binding pocket of Pin1 and the phosphate moiety of the substrate is dictated by the state of the substrate during catalysis
23976970 The PIN1 -842G>C polymorphism is associated with decreased cancer risk, but that the -667T>C polymorphism is not. (Meta-analysis)
23972472 Domain interactions increase Pin1 affinity toward peptide ligands.
23970419 Pin1 acts as a negative regulator of the G2/M transition by interacting with the Aurora-A-Bora complex.
23874525 These results suggest that the PIN1 rs2233678 (-842 G>C) polymorphism significantly reduces cancer risk.
23863879 Phosphorylation of HIV-1 CA at serine residue 16 is involved in the HIV-1 core uncoating process. Interaction of PIN1 with the CA core within the target cells is required for the uncoating process
23754278 Data indicate that Pin1 is up-regulated in dopaminergic neurons in cell culture, animal models, and human Parkinson disease (PD) brains. Pin1 inhibition protects dopaminergic neurons in PD models.
23716601 Pin1 and c-Myc are cooverexpressed in cancer, and this drives a gene expression pattern that is enriched in poor-outcome breast cancer subtypes.
23708493 A positive correlation of Pin1 and Nanog expression in human gliomas was noted.
23648381 up-regulation of Pin1 can amplify multiple oncogenic signaling pathways, resulting in cancers, while the down-regulation of Pin1 can cause many pathological characteristics of AD
23633483 A critical role for SENP1-mediated desumoylation in promoting Pin1 function during tumorigenesis.
23623683 PIN1 impinges on CtIP stability by promoting its ubiquitylation.
23606538 data show that Pin1 prevents Fas-mediated apoptosis in activated eosinophils via interactions with phospho-FADD
23542176 As Pin1 impacts both ERalpha protein levels and transactivation function, these data implicate Pin1 as a potential surrogate marker for predicting outcome of ERalpha-positive breast cancer
23487407 Data support a role for Pin1 as a central modulator of the intensity and duration of 2 major hypertrophic signaling pathways.
23421996 study identified Pin1 as a novel PRDX1 binding protein and proposed a mechanism for Pin1 in regulating the metabolism of reactive oxygen species in cells
23390529 The prolyl isomerase Pin1 acts synergistically with CDK2 to regulate the basal activity of estrogen receptor alpha in breast cancer.
23363774 exocytosis of secretory vesicles and gelatinase granules and activation of Pin1 are independent events required for TNF-mediated priming of neutrophil respiratory burst.
23362255 Isomerase Pin1 stimulates dephosphorylation of tau protein at cyclin-dependent kinase (Cdk5)-dependent Alzheimer phosphorylation sites
23333752 Functional interaction between PIN1 and survivin may therefore play an important role in hepatocarcinogenesis and chemoresistance.
23280577 we consider the activity that Pin1 plays on the N-terminal domain of different nuclear receptors and provide an interpretation of this phenomenon.
23274710 PIN1 gene polymorphisms (-842G/C and -667T/C) were unlikely to contribute to Alzheimer's disease susceptibility.
23272207 the phosphorylated peptides of the Bcl-2 loop can bind Pin1, further substantiating the phosphorylation-mediated conformation change of Bcl-2.
23269625 the minor genotypes of PIN1 promoter (-667CT, -667CC and -842CG) were associated with decreased risk of NPC in a Chinese population.
23231502 Cys-113 of Pin1 is adducted in MDA-MB-231 cells treated with 4-Hydroxynonenal, which is a common product of oxidative damage to lipids.
23221557 Authors found that Epstein-Barr virus DNA polymerase BALF5 subunit interacts with Pin1 through BALF5 Thr178 in a phosphorylation-dependent manner.
23193159 the isomerase activity of Pin1 inhibited PIP4K activity.
23129219 Overexpression of the prolyl isomerase PIN1 promotes cell growth in osteosarcoma.
23096908 Association between mutations in NR5A1 and PIN1 and idiopathic hypogonadotropic hypogonadism.
23067222 Overexpression of PIN1 is associated with malignant melanoma.
23054026 The -842G>C genetic variant in PIN1 promoter may decrease the promoter activity, resulting in changes in the levels of PIN1 and modifying cancer susceptibility.
23030417 eto lucidate the mechanism of catalysis of Pin1, the reaction in solution and in the catalytic cavity of the enzyme were compared
23025283 The study presents a kinetic and thermodynamic characterization of the isomer-specific interaction between Pin1-WW domain and the APP cytoplasmic tail phosphorylated at Thr668.
22986147 Study shows that acidic pH can induce kinds of irreversible structural changes in Pin1, such as the exposure of the hydrophobic side-chains, the transition from alpha-helix to beta-sheet and the aggregation of Pin1, and also explains why Pin1 loses activity below pH 5.0. The results emphasize the important role of decreased pH in the pathogenesis of some Pin1-related diseases.
22935610 Pin1 is required for efficient mitochondrial localization of p53 and potentiates the transcription-independent apoptotic activity of p53.
22926167 Pin1 is posttranslationally modified on more than 5 residues, via phosphorylation, N-acetylation, and oxidation. Pin1 expression remained constant but Pin1 posttranslational two-dimensional pattern was modified by tau overexpression in Alzheimer disease.
22907757 data suggest that Pin1 and PP2A act to coordinate the degradation of SLBP by the ubiquitin proteasome system and the exosome-mediated degradation of the histone mRNA by regulating complex dissociation.
22894932 ARSer81 is involved in the interaction with Pin1.
22789442 Pin1 enhances the transcriptional activity of all three NR4A nuclear receptors and increases protein stability of Nur77 through inhibition of its ubiquitination.
22608923 Pin1-mediated inhibition of Fbw7 contributes to oncogenesis
22580604 Knocking down Pin1 enhances the cellular levels and transcriptional activity of RUNX3 by inhibiting the ubiquitination and degradation of RUNX3
22566623 These findings collectively suggest that the MLK3-Pin1 signaling cascade plays a critical role in regulating the cell cycle, centrosome numbers, and oncogenesis.
22549912 The prolyl isomerase Pin1 interacts with and downregulates the activity of AMPK leading to induction of tumorigenicity of hepatocarcinoma.
22322860 Pin1 regulates tumor cell proliferation through direct interaction with the spacer domain of the pRb protein, and allows the interaction between CDK/cyclin complexes and pRb in mid/late G1.
22261503 This study demonistrated that the modifications of Pin1 found in LOAD subjects support its involvement in the pathogenesis of the disease with an important role being played by epigenetic mechanisms.
22184106 a novel role of Pin1 in inhibiting GSK3beta kinase activity to reduce APP protein levels, providing a previously unrecognized mechanism by which Pin1 protects against Alzheimer disease.
22158035 Data show that peptidyl-prolyl isomerase Pin1 silencing in SKBR-3 and MCF7 cells increased the cyclin-dependent kinase 10 (CDK10) expression.
22115795 The overexpression of Plk1 or Pin1 inhibited apoptotic signals following the cleavage of PARP in 5'-NIO-treated cells.
22064478 Estrogen receptor alpha unstructured transactivation domain (AF1) activity is regulated by S118 phosphorylation-dependent recruitment of PIN1.
22033920 a model in which Pin1 promotes PML degradation in an ERK2-dependent manner.
22011578 demonstrate that expression of mHtt causes increased phosphorylation of p53 on Ser46, leading to its interaction with phosphorylation-dependent prolyl isomerase Pin1
21980916 Reduced amide Pin1 inhibitor adopts a conformation similar to the proposed twisted-amide transition state of Pin1, with a trans-pyrrolidine conformation of the prolyl ring.
21967280 A detailed atomistic picture of the mechanism of Pin1 recognition is presented that can be exploited for drug design purposes and to further our understanding of synergistic complexities of post-translational phosphorylation and cis-trans isomerization.
21876001 activated Ras induces extracellular signal-regulated kinase 1 and 2-dependent phosphorylation of PTP-PEST at S571, which recruits PIN1 to bind to PTP-PEST
21852138 Prolyl isomerase Pin1 as a molecular switch to determine the fate of phosphoproteins
21850685 data suggest that functional c.-842C variants and haplotype "C-C" in the PIN1 promoter contribute to decreased risk of lung cancer by diminishing the promoter activity, which may be susceptibility biomarkers for lung cancer.(PIN1 gene
21764651 These observations suggest Pin1 may have a mild tumor suppressive role in clear cell renal cell carcinoma.
21750208 EGCG directly suppresses the tumor-promoting effect of Pin1
21746900 interactions between the peptidyl-prolyl isomerase and Trp-Trp (WW) domains amplify the conduit response, and alter binding properties at the remote peptidyl-prolyl isomerase active site
21745146 polymorphic variants of PIN1 -842(G > C) and -667(T > C) genes may not appear to have an influence on breast cancer risk among Malaysian Malay, Chinese and Indian women
21741598 These results define a Pin1/mutant p53 axis that conveys oncogenic signals to promote aggressiveness in human cancers.
21714498 Pin1 and phosphatase inhibitor-2 are conserved among eukaryotes from yeast to humans, make an ancient partnership that provides a means for regulating Pin1 specificity and function.
21693590 Pin1 has many important spindle substrates, this might represent a general mechanism for localization of mitotic signalling proteins.
21682951 Pin1-mediated phosphorylation-dependent prolyl isomerisation represents a unique signalling mechanism that has a pivotal role in the development of disease including cancer and Alzheimer disease and aging [review]
21680504 Pin1 interacts with both the NS5A and NS5B proteins of hepatitis C virus and modulates virus propagation.
21660049 following stress-induced phosphorylation of Thr in the Thr-Pro motif of JNK1, JNK1 associates with Pin1 and undergoes conformational changes to promote the binding of JNK1 to its substrates, resulting in cellular responses from extracellular signals.
21573702 PI3-kinase/p38 kinase-dependent E2F1 activation is critical for Pin1 induction in tamoxifen-resistant breast cancer cells.
21497122 Phosphorylation of Pin1 Ser71 by DAPK1 inhibits its catalytic activity and cellular function, providing strong evidence for an essential role of the Pin1 enzymatic activity for its cellular function.
21454638 Pin1 binds to IRS-1 and thereby markedly enhances insulin action, essential for adipogenesis.
21296877 Pin1 function could be a potential strategy for the stable induction and proliferation of human iPS cells.
21255181 These results suggest that Pin1 may be involved in the pathogenesis of rheumatoid arthritis
21243369 PIN1 changes are a constant feature of Alzheimer disease pathology and could serve as a biomarker of the onset or spread of Alzheimer disease neuropathology independent of tau or amyloid beta(Abeta) proteins.
21152000 Combine NMR relaxation experiments with simulation to show networks of inter-converting conformers. We demonstrate our approach with the apo Pin1-WW domain, for which NMR has revealed conformational dynamics of a flexible loop in the millisecond range.
21051667 Pin1 prolyl isomerase regulates endothelial nitric oxide synthase.
20735350 the role of Pin1 in cancer and neurodegeneration, the relationship between Pin1 and aging, its potential as a diagnostic and therapeutic target (Review)
20675384 the association of Pin1 with CRTC2 to decrease the nuclear CBP.CRTC.CREB complex.
20622153 Data show that phosphorylation promotes the interaction between Nanog and the prolyl isomerase Pin1, leading to Nanog stabilization by suppressing its ubiquitination.
20580132 This study report a functional polymorphism, rs2287839, in the Pin1 promoter that is significantly associated with a 3-year delay in the average age at onset (AAO) of late-onset AD in a Chinese population.
20580132 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20569234 The Pin1 inhibition leads to senescence in late-passage cells, and ectopic Pin1 expression rescues cells from BTG2-induced senescence.
20529865 Suppression of Pin1 expression by RNA interference in a target cell results in an attenuated HIV-1 replication and increases the amount of particulate CA cores in the cytosol of target cells.
20529865 Phosphorylation of HIV-1 CA at serine residue 16 is involved in the HIV-1 core uncoating process. Interaction of PIN1 with the CA core within the target cells is required for the uncoating process
20479004 Pin1 induces LC-3 expression and mediates tamoxifen resistance in breast cancer
20376080 Elevated PIN1 expression is associated with acute myeloid leukemia.
20359085 There was significant direct correlation between the expression of Pin1 and Cyclin D1 in laryngeal papilloma.
20180533 Data show that binding of the most potent inhibitors to Pin1 had K(D) (and K(I)) values in the low nanomolar range.
20179161 Pin1 plays an important role in the overexpression of HER-2 through Pin1-MEK1-activator protein-2alpha signaling in breast cancer.
20179103 Pin1 regulates BPGAP1 function in Rho and Erk signalling, with active Mek2 serving as a novel regulatory scaffold that promotes crosstalk between RhoGAP, Pin1 and Erk in the regulation of cell migration.
20173753 catalyzes conformational modification of HIV-1 integrase after the integrase is phosphorylated by JNK, allowing efficient HIV-1 integration into CD4+ cells
20173753 Phosphorylation of HIV-1 CA at serine residue 16 is involved in the HIV-1 core uncoating process. Interaction of PIN1 with the CA core within the target cells is required for the uncoating process
20110589 Pin1 activity regulates the proline-directed kinase in-duced biochemical and biological events and conse-quently regulates cell proliferation, cell survival, andapoptosis.
20060900 Prolyl-peptidyl isomerase, Pin1, phosphorylation is compromised in association with the expression of the HFE polymorphic allele, H63D.
20033770 Carriers of -842C variant alleles had decreased risk of breast cancer. No such associations were observed for PIN1 -667T>C and PIN1 Gln33Gln, but their haplotypes were also associated with reduced risk of breast cancer.
20033770 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20009523 High expression of Pin1 correlated with poor survivial in NSCLC patients. Overexpression of Pin1 in Glc82 cells increased cell growth and colony formation and tumorigenicity in nude mice including cell migration, invasion.
19996102 Pin1 regulates macrophage function through the direct binding to the phosphorylated AF-1 domain of PPARgamma
19940183 This study highlights a novel signaling role of PP2A by Pin1 and implicates Pin1 as a therapeutic target to reduce aberrant phosphorylation of NF proteins in neurodegenerative disorders such as AD, PD, and ALS.
19920136 the importance of Pin1 in TGF-beta-induced migration and invasion of cancer cells
19909517 Our data does not support the role of PIN1 common polymorphisms as Alzheimer's disease risk factor
19909517 Observational study of gene-disease association. (HuGE Navigator)
19904610 Pin1 induces cell cycle arrest and apoptosis in vascular smooth muscle cells.
19885590 overexpression of Pin-1 and VEGF-C may promote tumor progression and metastasis
19855176 Pin1 regulates Plk1-mediated phosphorylation of Cep55.
19846884 Pin1 may stimulate the transcription of proinflammatory proteins in rheumatoid arthritis tissues.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19682092 These results suggest that Pin1 may have overlapping cellular function with PCIF1.
19681904 Pin1 overexpression in tamoxifen-resistant -MCF-7 cells is involved in the epithelial-mesenchymal transition process via PTEN-PI3-kinase-Akt-GSK-3beta and/or GSK-3beta-NF-kappaB-dependent Snail activation
19668231 Pin1 is an important regulator of NF-kappaB in glioblastoma, and support the notion of using Pin1 as a therapeutic target in the future.
19638580 Pin1 regulates cytokinesis and may under pathologic levels stimulate tumorigenesis.
19625347 Hypothesis that common polymorphisms in the coding and promoter regions of PIN1 are associated with risk of squamous cell carcinoma of the head and neck/ the -842C variant genotypes are associated with decreased risk.
19625347 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19619441 Pin1 is overexpressed in circulating mononuclear cells from non-small cell lung cancer patients.
19597489 Study suggests that the Pin1 activity is often translated into a fate-determining ubiquitylation switch, and that Pin1 may affect the degree of substrate ubiquitylation in other pathways as well.
19592546 Report expression of Pin1 mRNA in non-small-cell lung cancer patients.
19584057 reveals a novel regulatory mechanism for p27(Kip1) stability and sheds new light on the biological function of Pin1 as a general regulator of protein stability.
19565466 only a small subset of side chain interactions within the hPin1 WW domain are mandatory for acquiring and maintaining a stable, cooperatively folded beta-sheet structure.
19502098 data shows that Pin1 is overexpressed and hypophosphorylated in HNSCC, and that inhibition of Pin1 blocks cell cycle progression and triggers tumor cell death.
19458071 Pin1 is an important regulator of Rel/NF-kappaB transforming activity and may be a potential therapeutic target in Rel/NF-kappaB-dependent leukemia/lymphomas.
19439498 Cytosolic SULT4A1 interacts with PIN1.
19338781 This study demonstrates an important role for Pin1 in the post-translational regulation of Tax and suggests that the targeting of Pin1 may offer a new insight into the pathogenesis of HTLV-1 related diseases.
19288014 The overexpression of Pin1 can be used as an indicator for pathological diagnosis of oral squamous cell carcinoma (OSCC).
19287979 Pin1 may influence cyclinD1 and p53 functions and predict chemoradiotherapy sensitivity.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19158244 The authors show here that prolyl isomerase Pin1 is over expressed in HTLV-1 cell lines; Pin1 binds Tax and regulates Tax-induced NF-kappaB activation.
19151708 In human breast cancers, we observed a strong correlation between Pin1 overexpression and high levels of activated Notch1. Thus, the molecular circuitry established by Notch1 and Pin1 may have a key role in cancer.
19141981 pin1 mRNA was overexpressed in the circulation of non-small cell lung cancer patients.
19122240 Pin1 negatively regulates TGF-beta signaling by down-regulating Smad2/3 protein levels via induction of Smurf2-mediated ubiquitin-proteasomal degradation.
19084525 Point mutations of several basic amino acids in the PPIase domain of Pin1 significantly compromise its nuclear localization.
19077306 Pin1 is a novel regulator of erbB2 that modulates the ubiquitin-mediated degradation of erbB2.
18844375 H59 and H157 are not required for hydrogen bonding within the active site, and in contrast to the active site C113, they do not participate directly in catalysis.
18794148 Pin1 is identified as a novel negative FOXO regulator, interconnecting FOXO phosphorylation and monoubiquitination in response to cellular stress to regulate p27(kip1).
18684817 Results show that the prolyl isomerase Pin1 modulates APOBEC3G expression.
18684817 Phosphorylation of HIV-1 CA at serine residue 16 is involved in the HIV-1 core uncoating process. Interaction of PIN1 with the CA core within the target cells is required for the uncoating process
18676833 Erk could phosphorylate Mcl-1 at two consensus residues, Thr 92 and 163, which is required for the association of Mcl-1 and Pin1, resulting in stabilization of Mcl-1
18676680 Observational study of gene-disease association. (HuGE Navigator)
18635547 Pin1 as a possible modulator of stress-induced NF-H phosphorylation as seen in neurodegenerative disorders like AD and amyotrophic lateral sclerosis
18294451 These results imply that Pin1 stimulates VEGF expression by activating HIF-1alpha and AP-1, and suggest that Pin1 is a potential therapeutic target of angiogenesis during cancer development.
18188456 Pin1 promoted the stability of TGF-beta1 mRNA in human Eos.
18062707 Recombinant Pin1 was modulated by I-2, and binding to individual mitotic phosphoproteins was increased, decreased or unaffected by I-2, showing that I-2 allosterically modifies Pin1 specificity.
18039859 Binding to Pin1 results in degradation of PML in a phosphorylation-dependent manner. Degradation of PML due to Pin1 acts both to protect a breast cancer tumor cell line from hydrogen peroxide-induced death and to increase the rate of proliferation.
18007120 Observational study of gene-disease association. (HuGE Navigator)
18007120 polymorphisms of the PIN-1 gene can affect neurodegeneration and its clinical progression.
18006688 PIN1 modulates RNA polymerase II activity during the transcription cycle.
17938171 Pin1-mediated prolyl isomerization plays an important role in the negative regulation of Daxx and thereby inhibits the oxidative stress-induced cellular apoptotic response, particularly in malignant tumor cells where Pin1 is often overexpressed.
17906639 Data suggest that Pin1 is required for efficient loading of p53 on target promoters upon stress, and that after phosphorylation of p53 triggered by cytotoxic stimuli, Pin1 mediates p53's dissociation from iASPP, promoting cell death.
17766376 Replacement of two nearest neighbor non-hydrogen-bonded residues on adjacent beta-strands with tryptophan residues increases beta-sheet thermodynamic stability of the Pin1 WW domain.
17681194 Interaction between Pin1 and hepatitis B virus protein HBx leads to hepatocarcinogenesis.
17626162 Isomerization of lys-ser-pro repeat residues that are abundant in NF-H tail domains by Pin1 can regulate NF-H phosphorylation.
17624454 PIN1 down-regulates BIRC5.
17482359 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17482359 none of the six common SNPs in Pin1, including the two promoter SNPs, rs223678 and rs223679, was associated with increased late-onset Alzheimer's disease risk
17468107 Che-1 as a new Pin1 and HDM2 target and confirm its important role in the cellular response to DNA damage.
17466629 the interaction of Pin1 with chromatin is greatly elevated in G2/M phase, and this correlates with the presence on chromosomes of several mitotic phosphoproteins, especially topoisomerase (Topo) IIalpha
17393110 PIN1 overexpression in hepatocellular carcinoma and its significance is reported.
17355867 This first side-chain dynamics study of human Pin1 lays the foundation for analysis of how different substrates elicit different dynamic responses from Pin1.
17334375 These results suggest that sequences of recognition motifs may reflect natural selection of not only chemical properties but also dynamic modes that augment specificity.
17317113 Pin1 deregulation may provide a link between formation of tangles and plaques in Alzheimer's disease [review]
17316687 A model for the reaction trajectory of Pin1 catalysis.
17163675 In this review, the authors show that Pin1 specifically regulates the degradation of amyloid precursor protein (APP), and they propose an alternative model for Pin1 regulation of APP processing.
17129455 The Pin1 and beta-catenin signalling pathways were activated in salivary adenoid cystic carcinoma.
17082615 Pin1 is implicated in granulocyte-macrophage colony-stimulating factor (GM-CSF) mRNA turnover, accumulation, and cytokine production by human T lymphocytes.
16972081 In human neuroblastoma cells, Pin1 is downregulated in response to endoplasmic reticulum stress in neuroblastoma cells.
16907857 Pin1 may not play a role in the development or progression of gastric cancer.
16865250 High levels of Pin1 expression is associated with salivary adenoid cystic carcinoma
16820873 Pin1 expression is correlated with cyclinD1 expression and may have a role in esophageal squamous cell carcinoma
16701948 Observational study of gene-disease association. (HuGE Navigator)
16701948 two promoter polymorphisms (rs2233678 and rs2233679)in PIN1 do not make a significant contribution to AD risk.
16697218 Pin1 level was found strongly increased during neuronal differentiation and tightly correlated with Tau dephosphorylation at Thr231
16476580 we found that Pin1 could interact with Nek6, one of the human NIMA-related kinases (Neks). Significant correlations between Nek6 and Pin1 mRNA expression levels in 40 pairs of hepatocellular carcinoma cases.
16449657 Pin1 overexpression correlates with centrosome amplification in breast cancer tissues.
16428447 High Pin1 expression in primary prostate cancer markedly inhibits the beta-catenin interaction with androgen receptor.
16384626 Observational study of gene-disease association. (HuGE Navigator)
16273101 Pin1 is a key mediator of granulocyte-macrophage colony-stimulating factor (GM-CSF) production
16227615 Pin1 functions as a transcriptional coactivator of nuclear receptors by modulating SRC-3 coactivator protein-protein complex formation and by also promoting the turnover of the activated SRC-3 oncoprotein.
16139797 Thus, Pin1 interacts with C99 and promotes its gamma-cleavage, generating Abeta40 and Abeta42.
16124054 Overexpression of Pin1 and beta-catenin may be closely related with the development and/or progression of colorectal carcinoma and further supports that Pin1 overexpression might contribute to the upregulation of beta-catenin.
16123044 c-Fos represents a novel target for the isomerizing activity of Pin1, which has a role in the mechanism by which c-Jun and c-Fos cooperate to regulate AP-1-dependent gene transcription
16095818 Observational study of gene-disease association. (HuGE Navigator)
16095818 We conclude that Pin1 is a very well conserved gene, whose rare nucleotide variations have no effect on the individual genetic risk for AD.
15964795 Mutations in proline 82 of p53 impair its activation by PIN1 and CHK2 in response to DNA damage.
15950321 Taken together, these results provide evidence supporting a direct link between oxidative damage to neuronal Pin1 and the pathobiology of Alzheimer disease.
15867923 Phosphorylation-dependent prolyl isomerization by Pin1 remains a unique mode for the modulation of signal transduction [review].
15701524 Pin1 binding was favored when at least two of the three threonine residues were phosphorylated
15474361 Pin1 redistribution and shortfalls occur in frontotemporal dementias characterized by abnormal protein aggregates of tau and other cytoskeletal proteins. may be unifying, contributory factor towards neuronal death in these dementias.
15175157 The ability of c-Abl and p300 to increase p73 stability and transcriptional activity requires Pin1. Pin1 is essential for activation of the apoptotic response by endogenous p73.
15111319 Pin1 can suppress transformed phenotypes and inhibit tumor cell growth
14967043 An additional interaction site between Pin1 and neuronal Tau protein identified at phospho-Thr212-Pro213 of Tau raises the question of functional cooperativity between the WW and catalytic domain of Pin1 while it interacts with hyperphosphorylated Tau.
14690596 Data show that NF-kappaB function is regulated by Pin1-mediated prolyl isomerization and ubiquitin-mediated proteolysis of its p65/RelA subunit.
14572447 Appearance of Pin1 granules in the early stages of Alzheimer's disease, Pick's disease, and FTDP-17 (P301L) tauopathy implicates Pin1 in their pathogenesis, but not in progressive supranuclear palsy.
12792768 Pin1 is a regulator of Cyclin D1 expression in oral squamous cell carcinoma and might have a role in oncogenesis
12721297 analysis of pin1 domain architecture and substrate binding
12686540 Peptide binding induces large scale changes in inter-domain mobility in human Pin1
12579289 Pin1 is overexpressed in oral squamous cell carcinoma and its levels correlate with cyclin D1 overexpression
12410395 Neurons containing Pin1 granules were devoid of neurofibrillary tangles. Granular accumulation of Pin1 may correspond to an absence of neurofibrillary lesions in these cells and might be associated with other mechanisms of neuronal degeneration.
12397362 following stress-induced phosphorylation, p53 needs to form a complex with Pin1 and to undergo a conformational change to fulfil its biological roles
12397361 The prolyl isomerase Pin1 is a regulator of p53 in genotoxic response
12388558 role in regulating p53 function during DNA damage
12153046 1H, 13C and 15N backbone resonance assignment of the peptidyl-prolyl cis-trans isomerase Pin1.
12101225 Pin1 is an E2F target gene that is essential for the Neu/Ras-induced transformation of mammary epithelial cells through activation of cyclin D1
11988841 conformational change of Bcl2 due to association with peptidyl prolyl isomerase can contribute to irreversible apoptotic signaling.
11978535 A signaling mechanism is proposed, whereby Pin1 specifically isomerizes only the phosphorylated Ser/Thr-Pro bonds in proteins, regulating protein function by inducing conformational changes following phosphorylation.
11940573 Interactions between protein kinase CK2 and Pin1. Evidence for phosphorylation-dependent interactions.
11787050 induction of expression by IGF-1 and role in promoting cell cycle S-phase entry
11575923 binds phosphorylated hSpt5

AA Sequence

MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRP      1 - 70
SSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFA     71 - 140
LRTGEMSGPVFTDSGIHIILRTE                                                   141 - 163
//

Text Mined References (310)

PMID Year Title
26977025 2016 Expression of PIN1 in Gastrointestinal Stromal Tumours and its Clinical Significance.
26917410 Targeting peptidyl-prolyl isomerase pin1 to inhibit tumor cell aggressiveness.
26874277 2016 Prolyl isomerase Pin1 regulates doxorubicin-inducible P-glycoprotein level by reducing Foxo3 stability.
26784107 2016 Peptidyl Prolyl Isomerase PIN1 Directly Binds to and Stabilizes Hypoxia-Inducible Factor-1?.
26752745 2016 Prolyl isomerase Pin1 promotes survival in EGFR-mutant lung adenocarcinoma cells with an epithelial-mesenchymal transition phenotype.
26651388 2016 Conserved Hydration Sites in Pin1 Reveal a Distinctive Water Recognition Motif in Proteins.
26461058 2015 Pin1 facilitates NF-?B activation and promotes tumour progression in human hepatocellular carcinoma.
26456073 2015 Structural Analysis of the Pin1-CPEB1 interaction and its potential role in CPEB1 degradation.
26406962 2015 Modulating the Affinities of Phosphopeptides for the Human Pin1 WW Domain Using 4-Substituted Proline Derivatives.
26387736 2015 ATR Plays a Direct Antiapoptotic Role at Mitochondria, which Is Regulated by Prolyl Isomerase Pin1.
26381174 2015 Autophagy regulated by prolyl isomerase Pin1 and phospho-Ser-GSK3?? involved in protection of oral squamous cell carcinoma against cadmium toxicity.
26276391 2015 Prolyl isomerase Pin1 negatively regulates AMP-activated protein kinase (AMPK) by associating with the CBS domain in the ? subunit.
26236013 2015 Pin1-Induced Proline Isomerization in Cytosolic p53 Mediates BAX Activation and Apoptosis.
26226559 2015 Allosteric Breakage of the Hydrogen Bond within the Dual-Histidine Motif in the Active Site of Human Pin1 PPIase.
26150353 2015 The role of Pin1 protein in aging of human tendon stem/progenitor cells.
26133706 2015 Peptidyl-Prolyl cis/trans Isomerase NIMA-Interacting 1 as a Therapeutic Target in Hepatocellular Carcinoma.
26039047 2015 Pin1 Inhibitor Juglone Exerts Anti-Oncogenic Effects on LNCaP and DU145 Cells despite the Patterns of Gene Regulation by Pin1 Differing between These Cell Lines.
25921067 2015 Human chromosome segregation involves multi-layered regulation of separase by the peptidyl-prolyl-isomerase Pin1.
25913034 2015 Pin1 liberates the human immunodeficiency virus type-1 (HIV-1): Must we stop it?
25866209 2015 Peptidylprolyl Isomerase Pin1 Directly Enhances the DNA Binding Functions of Estrogen Receptor ?.
25849135 2015 Active Pin1 is a key target of all-trans retinoic acid in acute promyelocytic leukemia and breast cancer.
25837727 2015 The structural and functional role of the three tryptophan residues in Pin1.
25818297 2015 The Rab2A GTPase promotes breast cancer stem cells and tumorigenesis via Erk signaling activation.
25766872 2015 Pin1: Intimate involvement with the regulatory protein kinase networks in the global phosphorylation landscape.
25742740 2015 Impairment of the Pin1/E2F1 axis in the anti-proliferative effect of bortezomib in hepatocellular carcinoma cells.
25675300 2015 Pin1 inhibits PP2A-mediated Rb dephosphorylation in regulation of cell cycle and S-phase DNA damage.
25667458 2015 Prolyl isomerase PIN1 negatively regulates SGK1 stability to mediate tamoxifen resistance in breast cancer cells.
25662955 2015 Landscape of Pin1 in the cell cycle.
25623232 2015 ZBP-89 reduces histone deacetylase 3 by degrading IkappaB in the presence of Pin1.
25588053 2015 KSHV reactivation and novel implications of protein isomerization on lytic switch control.
25583562 2015 Pin1 dysregulation helps to explain the inverse association between cancer and Alzheimer's disease.
25576397 2015 Pin1 cysteine-113 oxidation inhibits its catalytic activity and cellular function in Alzheimer's disease.
25553719 2015 Pin1-based diagnostic and therapeutic strategies for breast cancer.
25543254 2015 Two pathways mediate interdomain allosteric regulation in pin1.
25512367 2015 PIN1 inhibition suppresses osteoclast differentiation and inflammatory responses.
25463757 2015 Prolyl isomerase Pin1 regulates the osteogenic activity of Osterix.
25416956 2014 A proteome-scale map of the human interactome network.
25335736 2014 The Pin1 gene polymorphism and the susceptibility of oral squamous cell carcinoma in East China.
25280783 2015 Pin1 is overexpressed and correlates with poor prognosis in gastric cancer.
25182609 2014 Role of prolyl isomerase pin1 in pathogenesis of diseases and remedy for the diseases from natural products.
25174754 [Pin1: a multi-talented peptidyl prolyl cis-trans isomerase and a promising therapeutic target for human cancers].
25170559 2014 Can serum pin1 level be regarded as an indicative marker of nonalcoholic steatohepatitis and fibrotic stages?
25160749 2014 Pin1 positively affects tumorigenesis of esophageal squamous cell carcinoma and correlates with poor survival of patients.
25100325 2014 The C113D mutation in human Pin1 causes allosteric structural changes in the phosphate binding pocket of the PPIase domain through the tug of war in the dual-histidine motif.
25031083 2014 Role of pH in structural changes for Pin1 protein: an insight from molecular dynamics study.
24964035 2014 Pin1 promotes degradation of Smad proteins and their interaction with phosphorylated tau in Alzheimer's disease.
24915000 2014 MicroRNA-296-5p (miR-296-5p) functions as a tumor suppressor in prostate cancer by directly targeting Pin1.
24840168 2014 Cysteine-mediated dynamic hydrogen-bonding network in the active site of Pin1.
24786790 2014 Prolyl isomerase Pin1 acts downstream of miR200c to promote cancer stem-like cell traits in breast cancer.
24715170 2014 Peptidyl-prolyl isomerase Pin1-mediated abrogation of APC-?-catenin interaction in squamous cell carcinoma of cervix.
24530597 2014 Pin1 induction in the fibrotic liver and its roles in TGF-?1 expression and Smad2/3 phosphorylation.
24509437 2014 Phosphorylation of human immunodeficiency virus type 1 capsid protein at serine 16, required for peptidyl-prolyl isomerase-dependent uncoating, is mediated by virion-incorporated extracellular signal-regulated kinase 2.
24439903 2014 Chlamydia trachomatis-induced alterations in the host cell proteome are required for intracellular growth.
24416409 2014 The prolyl isomerase pin1 regulates mRNA levels of genes with short half-lives by targeting specific RNA binding proteins.
24357640 2014 Prolyl-isomerase Pin1 controls normal and cancer stem cells of the breast.
24311591 2013 Evidence for small-molecule-mediated loop stabilization in the structure of the isolated Pin1 WW domain.
24289610 2013 Pin1 promoter rs2233678 and rs2233679 polymorphisms in cancer: a meta-analysis.
24267382 2014 Structure of human Sp140 PHD finger: an atypical fold interacting with Pin1.
24265246 2015 COT phosphorylates prolyl-isomerase Pin1 to promote tumorigenesis in breast cancer.
24219242 2014 The role of PIN1 on odontogenic and adipogenic differentiation in human dental pulp stem cells.
24145406 2013 Autophosphorylation and Pin1 binding coordinate DNA damage-induced HIPK2 activation and cell death.
24126052 2013 Hyperthermia stress activates heat shock protein expression via propyl isomerase 1 regulation with heat shock factor 1.
24116866 2013 Kinetic isotope effects support the twisted amide mechanism of Pin1 peptidyl-prolyl isomerase.
24113655 2013 Prolyl isomerase Pin1 enhances osteoblast differentiation through Runx2 regulation.
24100296 2013 Pin1 promotes histone H1 dephosphorylation and stabilizes its binding to chromatin.
24072701 2013 Regulation of the microRNA 200b (miRNA-200b) by transcriptional regulators PEA3 and ELK-1 protein affects expression of Pin1 protein to control anoikis.
24021617 2013 Could Pin1 help us conquer essential hypertension at an earlier stage? A promising early-diagnostic biomarker and its therapeutic implications for the disease.
24013949 2013 The -842G/C polymorphisms of PIN1 contributes to cancer risk: a meta-analysis of 10 case-control studies.
23994618 2013 Destabilization of KLF10, a tumor suppressor, relies on thr93 phosphorylation and isomerase association.
23990466 2013 Mitotic regulation of SEPT9 protein by cyclin-dependent kinase 1 (Cdk1) and Pin1 protein is important for the completion of cytokinesis.
23982872 2014 Association of rs2233678 and rs2233679 polymorphisms in the PIN1 gene with cancer risk: a meta-analysis.
23980573 2013 Conformation-directed catalysis and coupled enzyme-substrate dynamics in Pin1 phosphorylation-dependent cis-trans isomerase.
23976970 2013 Single nucleotide polymorphisms of PIN1 promoter region and cancer risk: evidence from a meta-analysis.
23972472 2013 Transient domain interactions enhance the affinity of the mitotic regulator Pin1 toward phosphorylated peptide ligands.
23970419 2013 Pin1 acts as a negative regulator of the G2/M transition by interacting with the Aurora-A-Bora complex.
23911326 2013 A prolyl-isomerase mediates dopamine-dependent plasticity and cocaine motor sensitization.
23874525 2013 The rs2233678 polymorphism in PIN1 promoter region reduced cancer risk: a meta-analysis.
23754278 2013 The peptidyl-prolyl isomerase Pin1 up-regulation and proapoptotic function in dopaminergic neurons: relevance to the pathogenesis of Parkinson disease.
23716601 2013 Pin1 regulates the dynamics of c-Myc DNA binding to facilitate target gene regulation and oncogenesis.
23708493 2013 Pin1-Nanog expression in human glioma is correlated with advanced tumor progression.
23648381 2013 Focusing on the structure and the function of Pin1: new insights into the opposite effects of fever on cancers and Alzheimer's disease.
23633483 2013 SENP1 deSUMOylates and regulates Pin1 protein activity and cellular function.
23623683 2013 Prolyl isomerase PIN1 regulates DNA double-strand break repair by counteracting DNA end resection.
23606538 2013 Pin1-FADD interactions regulate Fas-mediated apoptosis in activated eosinophils.
23542176 2014 Pin1 modulates ER? levels in breast cancer through inhibition of phosphorylation-dependent ubiquitination and degradation.
23487407 2013 Regulation of cardiac hypertrophic signaling by prolyl isomerase Pin1.
23421996 2013 Regulation of PRDX1 peroxidase activity by Pin1.
23390529 2013 The prolyl isomerase Pin1 acts synergistically with CDK2 to regulate the basal activity of estrogen receptor ? in breast cancer.
23363774 2013 Exocytosis of neutrophil granule subsets and activation of prolyl isomerase 1 are required for respiratory burst priming.
23362255 2013 Isomerase Pin1 stimulates dephosphorylation of tau protein at cyclin-dependent kinase (Cdk5)-dependent Alzheimer phosphorylation sites.
23333752 2013 PIN1 inhibits apoptosis in hepatocellular carcinoma through modulation of the antiapoptotic function of survivin.
23280577 2013 Pin1 and nuclear receptors: a new language?
23274710 2013 PIN1-842G/C and -667T/C polymorphisms are not associated with the susceptibility of Alzheimer's disease: pooled analysis of epidemiologic studies.
23272207 2012 The natively disordered loop of Bcl-2 undergoes phosphorylation-dependent conformational change and interacts with Pin1.
23269625 2013 Association between PIN1 promoter polymorphisms and risk of nasopharyngeal carcinoma.
23231502 2013 Peptidyl-prolyl cis/trans-isomerase A1 (Pin1) is a target for modification by lipid electrophiles.
23221557 2013 Pin1 interacts with the Epstein-Barr virus DNA polymerase catalytic subunit and regulates viral DNA replication.
23193159 2012 Regulation of phosphatidylinositol-5-phosphate signaling by Pin1 determines sensitivity to oxidative stress.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23129219 2013 Overexpression of the prolyl isomerase PIN1 promotes cell growth in osteosarcoma cells.
23096908 2012 Mutations in NR5A1 and PIN1 associated with idiopathic hypogonadotropic hypogonadism.
23067222 2013 RNA-interference-mediated downregulation of Pin1 suppresses tumorigenicity of malignant melanoma A375 cells.
23054026 2013 Functional polymorphisms in PIN1 promoter and esophageal carcinoma susceptibility in Chinese population.
23030417 2012 How does Pin1 catalyze the cis-trans prolyl peptide bond isomerization? A QM/MM and mean reaction force study.
23025283 2012 Complete thermodynamic and kinetic characterization of the isomer-specific interaction between Pin1-WW domain and the amyloid precursor protein cytoplasmic tail phosphorylated at Thr668.
22986147 2012 The acidic pH-induced structural changes in Pin1 as revealed by spectral methodologies.
22935610 2013 The prolyl-isomerase Pin1 activates the mitochondrial death program of p53.
22926167 2013 Tau pathology modulates Pin1 post-translational modifications and may be relevant as biomarker.
22907757 2012 The prolyl isomerase Pin1 targets stem-loop binding protein (SLBP) to dissociate the SLBP-histone mRNA complex linking histone mRNA decay with SLBP ubiquitination.
22894932 2012 Androgen receptor serine 81 mediates Pin1 interaction and activity.
22789442 2012 Dual function of Pin1 in NR4A nuclear receptor activation: enhanced activity of NR4As and increased Nur77 protein stability.
22608923 2012 Negative regulation of the stability and tumor suppressor function of Fbw7 by the Pin1 prolyl isomerase.
22580604 2013 Prolyl isomerase Pin1 downregulates tumor suppressor RUNX3 in breast cancer.
22566623 2012 Mixed-lineage kinase 3 phosphorylates prolyl-isomerase Pin1 to regulate its nuclear translocation and cellular function.
22549912 2013 The prolyl isomerase Pin1 interacts with and downregulates the activity of AMPK leading to induction of tumorigenicity of hepatocarcinoma cells.
22322860 2012 Retinoblastoma tumor-suppressor protein phosphorylation and inactivation depend on direct interaction with Pin1.
22261503 2012 Pin1 contribution to Alzheimer's disease: transcriptional and epigenetic mechanisms in patients with late-onset Alzheimer's disease.
22184106 2012 Prolyl isomerase Pin1 promotes amyloid precursor protein (APP) turnover by inhibiting glycogen synthase kinase-3? (GSK3?) activity: novel mechanism for Pin1 to protect against Alzheimer disease.
22158035 2012 Proyl isomerase Pin1 facilitates ubiquitin-mediated degradation of cyclin-dependent kinase 10 to induce tamoxifen resistance in breast cancer cells.
22115795 2012 Inhibition of Plk1 and Pin1 by 5'-nitro-indirubinoxime suppresses human lung cancer cells.
22064478 2012 Regulation of estrogen receptor ? N-terminus conformation and function by peptidyl prolyl isomerase Pin1.
22033920 2011 Mitogen-activated protein kinase extracellular signal-regulated kinase 2 phosphorylates and promotes Pin1 protein-dependent promyelocytic leukemia protein turnover.
22011578 2011 Ser46 phosphorylation and prolyl-isomerase Pin1-mediated isomerization of p53 are key events in p53-dependent apoptosis induced by mutant huntingtin.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21980916 2011 A reduced-amide inhibitor of Pin1 binds in a conformation resembling a twisted-amide transition state.
21967280 2011 Conformational selection in the recognition of phosphorylated substrates by the catalytic domain of human Pin1.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21876001 2011 Ras-induced and extracellular signal-regulated kinase 1 and 2 phosphorylation-dependent isomerization of protein tyrosine phosphatase (PTP)-PEST by PIN1 promotes FAK dephosphorylation by PTP-PEST.
21852138 2011 Prolyl isomerase Pin1 as a molecular switch to determine the fate of phosphoproteins.
21850685 2011 The polymorphism and haplotypes of PIN1 gene are associated with the risk of lung cancer in Southern and Eastern Chinese populations.
21847096 2011 Pin1 and WWP2 regulate GluR2 Q/R site RNA editing by ADAR2 with opposing effects.
21764651 2011 Tumor suppressive activity of prolyl isomerase Pin1 in renal cell carcinoma.
21750208 2011 Epigallocatechin-gallate suppresses tumorigenesis by directly targeting Pin1.
21746900 2011 Stereospecific gating of functional motions in Pin1.
21745146 2011 Analysis of peptidyl-propyl-cis/trans isomerase 1 (PIN1) gene -842(G > C) and -667(T > C) polymorphic variants in relation to breast cancer risk and clinico-pathological parameters.
21743479 2011 Essential role for the prolyl isomerase Pin1 in Toll-like receptor signaling and type I interferon-mediated immunity.
21741598 2011 A Pin1/mutant p53 axis promotes aggressiveness in breast cancer.
21714498 2011 Molecular basis for an ancient partnership between prolyl isomerase Pin1 and phosphatase inhibitor-2.
21693590 2011 Localization of phosphorylated CK2alpha to the mitotic spindle requires the peptidyl-prolyl isomerase Pin1.
21682951 2011 Peptidyl-prolyl cis-trans isomerase Pin1 in ageing, cancer and Alzheimer disease.
21680504 2011 Peptidyl-prolyl isomerase Pin1 is a cellular factor required for hepatitis C virus propagation.
21660049 2012 A critical step for JNK activation: isomerization by the prolyl isomerase Pin1.
21573702 2011 PI3-kinase/p38 kinase-dependent E2F1 activation is critical for Pin1 induction in tamoxifen-resistant breast cancer cells.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21497122 2011 Death-associated protein kinase 1 phosphorylates Pin1 and inhibits its prolyl isomerase activity and cellular function.
21454638 2011 Peptidyl-prolyl cis/trans isomerase NIMA-interacting 1 associates with insulin receptor substrate-1 and enhances insulin actions and adipogenesis.
21296877 2011 A distinct role for Pin1 in the induction and maintenance of pluripotency.
21269460 2011 Initial characterization of the human central proteome.
21255181 2011 Possible involvement of peptidylprolyl isomerase Pin1 in rheumatoid arthritis.
21243369 2011 Granular expression of prolyl-peptidyl isomerase PIN1 is a constant and specific feature of Alzheimer's disease pathology and is independent of tau, A? and TDP-43 pathology.
21152000 2010 Modeling conformational ensembles of slow functional motions in Pin1-WW.
21051667 2011 Pin1 prolyl isomerase regulates endothelial nitric oxide synthase.
20735350 2010 Pin1: a new genetic link between Alzheimer's disease, cancer and aging.
20675384 2010 Pin1 associates with and induces translocation of CRTC2 to the cytosol, thereby suppressing cAMP-responsive element transcriptional activity.
20622153 2010 Phosphorylation stabilizes Nanog by promoting its interaction with Pin1.
20580132 2012 A PIN1 polymorphism that prevents its suppression by AP4 associates with delayed onset of Alzheimer's disease.
20569234 2010 BTG2 antagonizes Pin1 in response to mitogens and telomere disruption during replicative senescence.
20529865 2010 Uncoating of human immunodeficiency virus type 1 requires prolyl isomerase Pin1.
20479004 2010 The prolyl isomerase Pin1 induces LC-3 expression and mediates tamoxifen resistance in breast cancer.
20376080 2010 Elevated PIN1 expression by C/EBPalpha-p30 blocks C/EBPalpha-induced granulocytic differentiation through c-Jun in AML.
20359085 2009 [The expression and significance of Pin1 and CyclinD1 in adult papilloma of larynx].
20180533 2010 Membrane permeable cyclic peptidyl inhibitors against human Peptidylprolyl Isomerase Pin1.
20179161 2010 The prolyl isomerase Pin1 enhances HER-2 expression and cellular transformation via its interaction with mitogen-activated protein kinase/extracellular signal-regulated kinase kinase 1.
20179103 2010 Active Mek2 as a regulatory scaffold that promotes Pin1 binding to BPGAP1 to suppress BPGAP1-induced acute Erk activation and cell migration.
20173753 2010 Concerted action of cellular JNK and Pin1 restricts HIV-1 genome integration to activated CD4+ T lymphocytes.
20110589 2010 Phosphorylation-specific peptidyl-prolyl isomerization of neuronal cytoskeletal proteins by Pin1: implications for therapeutics in neurodegeneration.
20060900 2010 Prolyl-peptidyl isomerase, Pin1, phosphorylation is compromised in association with the expression of the HFE polymorphic allele, H63D.
20033770 2010 The functional promoter polymorphism (-842G>C) in the PIN1 gene is associated with decreased risk of breast cancer in non-Hispanic white women 55 years and younger.
20009523 2010 Pin1 expression contributes to lung cancer: Prognosis and carcinogenesis.
19996102 2010 Proline cis/trans-isomerase Pin1 regulates peroxisome proliferator-activated receptor gamma activity through the direct binding to the activation function-1 domain.
19940183 2009 Peptidyl-prolyl isomerase 1 regulates protein phosphatase 2A-mediated topographic phosphorylation of neurofilament proteins.
19920136 2010 Pin1 promotes transforming growth factor-beta-induced migration and invasion.
19909517 2009 PIN1 gene variants in Alzheimer's disease.
19904610 2010 Inhibition of peptidyl-prolyl cis/trans isomerase Pin1 induces cell cycle arrest and apoptosis in vascular smooth muscle cells.
19885590 2009 Interpretation of Pin-1 and VEGF-C expression in breast infiltrating duct carcinoma.
19855176 2009 Cep55 stabilization is required for normal execution of cytokinesis.
19846884 2009 Novel role of Pin1 induction in type II collagen-mediated rheumatoid arthritis.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19682092 2009 Prolyl isomerase Pin1 shares functional similarity with phosphorylated CTD interacting factor PCIF1 in vertebrate cells.
19681904 2009 Involvement of Pin1 induction in epithelial-mesenchymal transition of tamoxifen-resistant breast cancer cells.
19668231 2009 The prolyl isomerase Pin1 regulates the NF-kappaB signaling pathway and interleukin-8 expression in glioblastoma.
19638580 2009 The peptidyl-prolyl isomerase Pin1 regulates cytokinesis through Cep55.
19625347 2009 A novel functional variant (-842G>C) in the PIN1 promoter contributes to decreased risk of squamous cell carcinoma of the head and neck by diminishing the promoter activity.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19619441 2009 [Expression and significance of Pin1 mRNA in circulating mononuclear cells from non-small cell lung cancer patients during perioperative period].
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19597489 2009 Prolyl isomerase Pin1 acts as a switch to control the degree of substrate ubiquitylation.
19592546 2009 Expression of Pin1 mRNA in non-small-cell lung cancer patients.
19584057 2009 Pin1 catalyzes conformational changes of Thr-187 in p27Kip1 and mediates its stability through a polyubiquitination process.
19565466 2009 Sequence determinants of thermodynamic stability in a WW domain--an all-beta-sheet protein.
19502098 2009 The rotamase Pin1 is up-regulated, hypophosphorylated and required for cell cycle progression in head and neck squamous cell carcinomas.
19458071 2009 Peptidyl-prolyl isomerase Pin1 markedly enhances the oncogenic activity of the rel proteins in the nuclear factor-kappaB family.
19439498 2009 Cytosolic Aryl sulfotransferase 4A1 interacts with the peptidyl prolyl cis-trans isomerase Pin1.
19367327 2009 Protein kinase-X interacts with Pin-1 and Polycystin-1 during mouse kidney development.
19338781 2009 The prolyl isomerase Pin1 stabilizes the human T-cell leukemia virus type 1 (HTLV-1) Tax oncoprotein and promotes malignant transformation.
19288014 2009 Pin1 overexpression is associated with poor differentiation and survival in oral squamous cell carcinoma.
19287979 2009 Expression of the prolyl isomerase Pin1 is a useful indicator of sensitivity to chemoradiotherapy in advanced esophageal squamous cell carcinoma.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19158244 2009 Peptidylproline cis-trans-isomerase Pin1 interacts with human T-cell leukemia virus type 1 tax and modulates its activation of NF-kappaB.
19151708 2009 The prolyl-isomerase Pin1 is a Notch1 target that enhances Notch1 activation in cancer.
19141981 2008 [Expression of pin1 mRNA in the circulation of non-small cell lung cancer patients and influence of sequence of vessel ligation].
19122240 2009 Pin1 down-regulates transforming growth factor-beta (TGF-beta) signaling by inducing degradation of Smad proteins.
19084525 2009 Nuclear import of Pin1 is mediated by a novel sequence in the PPIase domain.
19077306 2008 Prolyl isomerase Pin1 is highly expressed in Her2-positive breast cancer and regulates erbB2 protein stability.
18844375 2008 The dual histidine motif in the active site of Pin1 has a structural rather than catalytic role.
18794148 2008 The peptidyl-isomerase Pin1 regulates p27kip1 expression through inhibition of Forkhead box O tumor suppressors.
18684817 2008 Human immunodeficiency virus type 1 replication and regulation of APOBEC3G by peptidyl prolyl isomerase Pin1.
18676833 2008 Down-regulation of myeloid cell leukemia-1 through inhibiting Erk/Pin 1 pathway by sorafenib facilitates chemosensitization in breast cancer.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18635547 2008 Pin1-dependent prolyl isomerization modulates the stress-induced phosphorylation of high molecular weight neurofilament protein.
18628984 2008 Nerve growth factor stimulates interaction of Cayman ataxia protein BNIP-H/Caytaxin with peptidyl-prolyl isomerase Pin1 in differentiating neurons.
18294451 2008 Induction of vascular endothelial growth factor by peptidyl-prolyl isomerase Pin1 in breast cancer cells.
18188456 2008 Pin1 regulates TGF-beta1 production by activated human and murine eosinophils and contributes to allergic lung fibrosis.
18062707 2008 Binding of phosphatase inhibitor-2 to prolyl isomerase Pin1 modifies specificity for mitotic phosphoproteins.
18039859 2008 Degradation of the tumor suppressor PML by Pin1 contributes to the cancer phenotype of breast cancer MDA-MB-231 cells.
18007120 2007 PIN-1 promoter polymorphisms in mild cognitive impairment and susceptibility to Alzheimer's disease: a preliminary report.
18006688 2007 Pin1 modulates RNA polymerase II activity during the transcription cycle.
17938171 2007 A suppressive role of the prolyl isomerase Pin1 in cellular apoptosis mediated by the death-associated protein Daxx.
17906639 2007 The prolyl isomerase Pin1 orchestrates p53 acetylation and dissociation from the apoptosis inhibitor iASPP.
17878917 2007 The prolyl isomerase PIN1: a pivotal new twist in phosphorylation signalling and disease.
17828269 2007 Genotoxic stress regulates expression of the proto-oncogene Bcl6 in germinal center B cells.
17766376 2007 A cross-strand Trp Trp pair stabilizes the hPin1 WW domain at the expense of function.
17681194 2007 Pin1-HBx interaction: a step toward understanding the significance of hepatitis B virus genotypes in hepatocarcinogenesis.
17626162 2007 Inhibition of Pin1 reduces glutamate-induced perikaryal accumulation of phosphorylated neurofilament-H in neurons.
17624454 2007 The peptidyl prolyl cis/trans isomerase Pin1 downregulates the Inhibitor of Apoptosis Protein Survivin.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17482359 2007 Association studies between common variants in prolyl isomerase Pin1 and the risk for late-onset Alzheimer's disease.
17468107 2007 The prolyl isomerase Pin1 affects Che-1 stability in response to apoptotic DNA damage.
17466629 2007 The prolyl isomerase Pin1 functions in mitotic chromosome condensation.
17393110 2007 PIN1 gene overexpression and beta-catenin gene mutation/expression in hepatocellular carcinoma and their significance.
17355867 2007 Substrate recognition reduces side-chain flexibility for conserved hydrophobic residues in human Pin1.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17334375 2007 Sequence-specific dynamics modulate recognition specificity in WW domains.
17317113 2007 Pin1 in Alzheimer's disease: multiple substrates, one regulatory mechanism?
17316687 2007 Structure and dynamics of pin1 during catalysis by NMR.
17163675 2006 Pin1 flips Alzheimer's switch.
17129455 2006 [Expression of Pin1, beta-catenin and cyclin D1 in salivary adenoid cystic carcinoma and its significance].
17082615 2006 The peptidyl-prolyl isomerase Pin1 regulates granulocyte-macrophage colony-stimulating factor mRNA stability in T lymphocytes.
16972081 2007 Pin1 levels are downregulated during ER stress in human neuroblastoma cells.
16907857 Pin1 gene mutation is a rare event in gastric cancer.
16865250 2006 Aberrant expression of beta-catenin, Pin1 and cylin D1 in salivary adenoid cystic carcinoma: relation to tumor proliferation and metastasis.
16820873 2006 Prolyl isomerase Pin1 expression predicts prognosis in patients with esophageal squamous cell carcinoma and correlates with cyclinD1 expression.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16701948 2006 Association study of the PIN1 gene with Alzheimer's disease.
16697218 Pin1 allows for differential Tau dephosphorylation in neuronal cells.
16644721 2006 Regulation of Bruton tyrosine kinase by the peptidylprolyl isomerase Pin1.
16554819 2006 The prolyl isomerase Pin1 regulates amyloid precursor protein processing and amyloid-beta production.
16476580 2006 Interaction of Pin1 with Nek6 and characterization of their expression correlation in Chinese hepatocellular carcinoma patients.
16449657 2006 Pin1 regulates centrosome duplication, and its overexpression induces centrosome amplification, chromosome instability, and oncogenesis.
16428447 2006 Activation of beta-catenin signaling in prostate cancer by peptidyl-prolyl isomerase Pin1-mediated abrogation of the androgen receptor-beta-catenin interaction.
16384626 2007 PIN1 promoter polymorphisms are associated with Alzheimer's disease.
16273101 2005 The peptidyl-prolyl isomerase Pin1 regulates the stability of granulocyte-macrophage colony-stimulating factor mRNA in activated eosinophils.
16227615 2005 Peptidyl-prolyl isomerase 1 (Pin1) serves as a coactivator of steroid receptor by regulating the activity of phosphorylated steroid receptor coactivator 3 (SRC-3/AIB1).
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16139797 2005 Pin1 promotes production of Alzheimer's amyloid beta from beta-cleaved amyloid precursor protein.
16124054 2005 Pin1 overexpression in colorectal cancer and its correlation with aberrant beta-catenin expression.
16123044 2005 Regulation of the transcriptional activity of c-Fos by ERK. A novel role for the prolyl isomerase PIN1.
16095818 2005 DNA sequence variations in the prolyl isomerase Pin1 gene and Alzheimer's disease.
16024801 2005 Sil phosphorylation in a Pin1 binding domain affects the duration of the spindle checkpoint.
15964795 2005 Mutations in proline 82 of p53 impair its activation by Pin1 and Chk2 in response to DNA damage.
15950321 2006 Oxidative modification and down-regulation of Pin1 in Alzheimer's disease hippocampus: A redox proteomics analysis.
15867923 2005 Phosphorylation-specific prolyl isomerization: is there an underlying theme?
15701524 2005 The multifunctional nuclear protein p54nrb is multiphosphorylated in mitosis and interacts with the mitotic regulator Pin1.
15664191 2005 Regulation of Raf-1 by direct feedback phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15474361 2004 Shortfalls in the peptidyl-prolyl cis-trans isomerase protein Pin1 in neurons are associated with frontotemporal dementias.
15175157 2004 Pin1 links the activities of c-Abl and p300 in regulating p73 function.
15111319 2004 Prevalent overexpression of prolyl isomerase Pin1 in human cancers.
14967043 2004 The peptidyl prolyl cis/trans-isomerase Pin1 recognizes the phospho-Thr212-Pro213 site on Tau.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14690596 2003 Regulation of NF-kappaB signaling by Pin1-dependent prolyl isomerization and ubiquitin-mediated proteolysis of p65/RelA.
14572447 2003 Pin1 colocalization with phosphorylated tau in Alzheimer's disease and other tauopathies.
14559993 2003 Regulation of alternative splicing by SRrp86 and its interacting proteins.
12881709 2003 Cell cycle-dependent phosphorylation of Disabled-2 by cdc2.
12792768 Expression status of Pin1 and cyclins in oral squamous cell carcinoma: Pin1 correlates with Cyclin D1 mRNA expression and clinical significance of cyclins.
12721297 2003 Structural analysis of the mitotic regulator hPin1 in solution: insights into domain architecture and substrate binding.
12686540 2003 Peptide binding induces large scale changes in inter-domain mobility in human Pin1.
12579289 Pin1 is overexpressed in oral squamous cell carcinoma and its levels correlate with cyclin D1 overexpression.
12540053 2002 Pin1: a therapeutic target in Alzheimer neurodegeneration.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12410395 2002 Inverse association of Pin1 and tau accumulation in Alzheimer's disease hippocampus.
12397362 2002 The prolyl isomerase Pin1 reveals a mechanism to control p53 functions after genotoxic insults.
12397361 2002 The prolyl isomerase Pin1 is a regulator of p53 in genotoxic response.
12388558 2002 Role of Pin1 in the regulation of p53 stability and p21 transactivation, and cell cycle checkpoints in response to DNA damage.
12153046 2002 1H, 13C and 15N backbone resonance assignment of the peptidyl-prolyl cis-trans isomerase Pin1.
12107413 2002 Expressed sequence tag analysis of adult human lens for the NEIBank Project: over 2000 non-redundant transcripts, novel genes and splice variants.
11988841 Proteasomal degradation of human peptidyl prolyl isomerase pin1-pointing phospho Bcl2 toward dephosphorylation.
11978535 2002 Pinning down proline-directed phosphorylation signaling.
11940573 2002 Interactions between protein kinase CK2 and Pin1. Evidence for phosphorylation-dependent interactions.
11787050 2002 IGF-1 induces Pin1 expression in promoting cell cycle S-phase entry.
11774038 Microtubule-targeting drugs induce bcl-2 phosphorylation and association with Pin1.
11741599 2001 Multiple interactions of the cytosolic polyproline region of the CD95 ligand: hints for the reverse signal transduction capacity of a death factor.
11575923 2001 The peptidyl-prolyl isomerase Pin1 interacts with hSpt5 phosphorylated by Cdk9.
11533658 2001 Pin1 regulates turnover and subcellular localization of beta-catenin by inhibiting its interaction with APC.
11470801 2001 Identification of a novel kinesin-related protein, KRMP1, as a target for mitotic peptidyl-prolyl isomerase Pin1.
11432833 2001 Pin1 is overexpressed in breast cancer and cooperates with Ras signaling in increasing the transcriptional activity of c-Jun towards cyclin D1.
11356192 2001 Binding and regulation of the transcription factor NFAT by the peptidyl prolyl cis-trans isomerase Pin1.
10939594 2000 Phosphorylation-dependent proline isomerization catalyzed by Pin1 is essential for tumor cell survival and entry into mitosis.
10932246 2000 Structural basis for phosphoserine-proline recognition by group IV WW domains.
10888662 2000 Accumulation of rab4GTP in the cytoplasm and association with the peptidyl-prolyl isomerase pin1 during mitosis.
10504341 1999 The C-terminal domain of the Cdc2 inhibitory kinase Myt1 interacts with Cdc2 complexes and is required for inhibition of G(2)/M progression.
10393805 1999 A hyperphosphorylated form of RNA polymerase II is the major interphase antigen of the phosphoprotein antibody MPM-2 and interacts with the peptidyl-prolyl isomerase Pin1.
10391244 1999 The prolyl isomerase Pin1 restores the function of Alzheimer-associated phosphorylated tau protein.
10037602 1999 Function of WW domains as phosphoserine- or phosphothreonine-binding modules.
9482729 1998 The mitotic peptidyl-prolyl isomerase, Pin1, interacts with Cdc25 and Plx1.
9299231 1997 The human PIN1 peptidyl-prolyl cis/trans isomerase gene maps to human chromosome 19p13 and the closely related PIN1L gene to 1p31.
9200606 1997 Structural and functional analysis of the mitotic rotamase Pin1 suggests substrate recognition is phosphorylation dependent.
8606777 1996 A human peptidyl-prolyl isomerase essential for regulation of mitosis.
8552658 1996 The Drosophila melanogaster dodo (dod) gene, conserved in humans, is functionally interchangeable with the ESS1 cell division gene of Saccharomyces cerevisiae.