Property Summary

Ligand Count 1,123
NCBI Gene PubMed Count 200
PubMed Score 758.76
PubTator Score 475.30

Knowledge Summary

Patent (56,710)

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 2.5e-03
Breast cancer 1.400 1.2e-05
cystic fibrosis -1.163 1.2e-04
esophageal adenocarcinoma -1.300 2.3e-02
lung cancer -1.200 2.3e-04
lung carcinoma -1.300 7.6e-13
malignant mesothelioma 1.500 2.3e-07
osteosarcoma -2.029 3.2e-05
ovarian cancer 1.400 1.5e-03
pancreatic cancer 1.100 1.1e-03
pancreatic carcinoma 1.100 1.1e-03
Rheumatoid arthritis 1.100 2.2e-02

Synonym

Accession P11309 Q38RT9 Q5T7H7 Q96RG3
Symbols PIM

Gene

PDB

1XQZ   1XR1   1XWS   1YHS   1YI3   1YI4   1YWV   1YXS   1YXT   1YXU   1YXV   1YXX   2BIK   2BIL   2BZH   2BZI   2BZJ   2BZK   2C3I   2J2I   2O3P   2O63   2O64   2O65   2OBJ   2OI4   2XIX   2XIY   2XIZ   2XJ0   2XJ1   2XJ2   3A99   3BGP   3BGQ   3BGZ   3BWF   3C4E   3CXW   3CY2   3CY3   3DCV   3F2A   3JPV   3JXW   3JY0   3JYA   3MA3   3QF9   3R00   3R01   3R02   3R04   3T9I   3UIX   3UMW   3UMX   3VBQ   3VBT   3VBV   3VBW   3VBX   3VBY   3VC4   3WE8   4A7C   4ALU   4ALV   4ALW   4AS0   4BZN   4BZO   4DTK   4ENX   4ENY   4GW8   4I41   4IAA   4JX3   4JX7   4K0Y   4K18   4K1B   4LL5   4LM5   4LMU   4MBI   4MBL   4MED   4MTA   4N6Y   4N6Z   4N70   4RBL   4RC2   4RC3   4RC4   4RPV   4TY1   4WRS   4WSY   4WT6   4XH6   4XHK   5C1Q   5DGZ   5DHJ   5DIA   5DWR   5EOL   5IIS   5IPJ   5KCX   5KGD   5KGE   5KGG   5KGI   5KGK   5KZI   5O11   5O12   5O13   5TEL   5TEX   5TOE   5TUR   5V82  

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Protein-protein Interaction (6)

Gene RIF (174)

AA Sequence

MPHEPHEPLTPPFSALPDPAGAPSRRQSRQRPQLSSDSPSAFRASRSHSRNATRSHSHSHSPRHSLRHSP      1 - 70
GSGSCGSSSGHRPCADILEVGMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGF     71 - 140
GSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLI    141 - 210
LERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGS    211 - 280
GALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFFRQRV    281 - 350
SSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK                    351 - 404
//

Text Mined References (205)

PMID Year Title