Property Summary

Ligand Count 1,139
NCBI Gene PubMed Count 200
PubMed Score 758.76
PubTator Score 475.30

Knowledge Summary

Patent (56,710)

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 2.5e-03
Breast cancer 1.400 1.2e-05
cystic fibrosis -1.163 1.2e-04
esophageal adenocarcinoma -1.300 2.3e-02
lung cancer -1.200 2.3e-04
lung carcinoma -1.300 7.6e-13
malignant mesothelioma 1.500 2.3e-07
osteosarcoma -2.029 3.2e-05
ovarian cancer 1.400 1.5e-03
pancreatic cancer 1.100 1.1e-03
pancreatic carcinoma 1.100 1.1e-03
Rheumatoid arthritis 1.100 2.2e-02

Protein-protein Interaction (6)

PDB (127)

Gene RIF (174)

AA Sequence

MPHEPHEPLTPPFSALPDPAGAPSRRQSRQRPQLSSDSPSAFRASRSHSRNATRSHSHSHSPRHSLRHSP      1 - 70
GSGSCGSSSGHRPCADILEVGMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGF     71 - 140
GSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLI    141 - 210
LERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGS    211 - 280
GALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFFRQRV    281 - 350
SSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK                    351 - 404
//

Text Mined References (205)

PMID Year Title