Property Summary

NCBI Gene PubMed Count 176
PubMed Score 700.51
PubTator Score 475.30

Knowledge Summary

Patent (56,710)

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis 1.100 2.2e-02
pancreatic cancer 1.100 1.1e-03
malignant mesothelioma 1.500 2.3e-07
esophageal adenocarcinoma -1.300 2.3e-02
osteosarcoma -2.029 3.2e-05
cystic fibrosis -1.163 1.2e-04
atypical teratoid/rhabdoid tumor 1.200 8.2e-05
lung cancer -1.200 2.3e-04
pancreatic carcinoma 1.100 1.1e-03
lung carcinoma -1.300 7.6e-13
ovarian cancer 1.400 1.5e-03
Breast cancer 1.400 1.2e-05

Synonym

Accession P11309 Q38RT9 Q5T7H7 Q96RG3
Symbols PIM

Gene

PDB

1XQZ   1XR1   1XWS   1YHS   1YI3   1YI4   1YWV   1YXS   1YXT   1YXU   1YXV   1YXX   2BIK   2BIL   2BZH   2BZI   2BZJ   2BZK   2C3I   2J2I   2O3P   2O63   2O64   2O65   2OBJ   2OI4   2XIX   2XIY   2XIZ   2XJ0   2XJ1   2XJ2   3A99   3BGP   3BGQ   3BGZ   3BWF   3C4E   3CXW   3CY2   3CY3   3DCV   3F2A   3JPV   3JXW   3JY0   3JYA   3MA3   3QF9   3R00   3R01   3R02   3R04   3T9I   3UIX   3UMW   3UMX   3VBQ   3VBT   3VBV   3VBW   3VBX   3VBY   3VC4   3WE8   4A7C   4ALU   4ALV   4ALW   4AS0   4BZN   4BZO   4DTK   4ENX   4ENY   4GW8   4I41   4IAA   4JX3   4JX7   4K0Y   4K18   4K1B   4LL5   4LM5   4LMU   4MBI   4MBL   4MED   4MTA   4N6Y   4N6Z   4N70   4RBL   4RC2   4RC3   4RC4   4RPV   4TY1   4WRS   4WSY   4WT6   4XH6   4XHK   5C1Q   5DGZ   5DHJ   5DIA   5DWR   5EOL   5IIS   5IPJ  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

  TechDev Info (1)

Michael McManus 22 Genetic interaction screen

Protein-protein Interaction (6)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (150)

PMID Text
26934497 glycogen synthase kinase 3 beta (GSK3B) and the forkhead box P3 (FOXP3) transcription factors are direct PIM1 targets.
26598507 demonstrate Pim1 as a novel kinase that is responsible for the phosphorylation of eNOS at Ser-633 and enhances endothelial cells sprouting of aortic rings from diabetic mice
26555723 By associating with PIM-1L, CD180 can thus obtain autonomous signaling capabilities, and this complex is then channeling inflammatory signals into B cell survival programs
26551340 A high percentage of urothelial carcinomas express Pim kinases. Pim expression differs in NILG, NIHG, and IHG lesions.
26472029 Data suggest that combining PIM and JAK2 kinase inhibitors may offer a more efficacious therapeutic approach for myeloproliferative neoplasms (MPNs) over JAK2 inhibitor mono-therapy.
26453516 Pim1 kinase activity maintains airway epithelial integrity and protects against house dust mite-induced proinflammatory activation of the airway epithelium.
26352175 Downregulation of microRNA33a promotes the expression CDK6, CCND1, and PIM1, and gastric cancer cell proliferation.
26202252 Pim kinase may represent a new host factor for HCV entry. Pim1 is an oncogenic serine/threonine kinase. HCV NS5A protein physically interacts with Pim1 and contributes to Pim1 protein stability.
26075720 Pim-1 and Pim-3 enhance phosphorylation and cell surface expression of CXCR4 in prostate cancer cells. PC-3 prostate cancer cells overexpressing either Pim-1 or Pim-3 kinases form larger xenograft tumors than the parental PC-3 cells.
25882843 Pim1 function depends upon intracellular localization in human cardiac progenitor cells
25834102 PIM1 is up-regulated by hypoxia in hepatocellular carcinoma and promotes tumor growth and metastasis by facilitating cancer cell glycolysis.
25553374 important role in progression of pre-malignant high grade prostatic intra-epithelial neoplasia to malignant prostatic carcinomas [review]
25551195 This study demonstrates the oncogenic role of Pim-1 in ACC. The findings also suggest that Pim-1 may serve as a neoteric therapeutic target and potential prognostic marker for ACC cancer
25451079 These results point on PIM1 as a novel factor in regulation of the phenotype and differentiation of fibroblasts in prostate cancer.
25342548 Pim-1 kinase could be a critical survival signaling factor in non-small-cell lung cancer, and regulated by miR-486-5p and eIF4E.
25238262 Data demonstrate the role of PIM kinases in driving myeloid leukemia, and as candidate molecules for therapy against human malignancies.
25155357 In comparison with normal brain, a strong upregulation of Pim1 was demonstrated in human GBM samples. Notably, patients with short overall survival showed a significantly higher Pim1 expression compared with GBM patients who lived longer than the median.
25121590 We now demonstrate a molecular mechanism which reveals a direct role for EBNA3C in enhancing Pim-1 expression in EBV-infected primary B-cells.
25104088 Overexpression of PIM-1 is associated with breast cancer.
25096571 PIM1-specific inhibitor boosted FOXP3 DNA binding activity in in vitro expanded primary Tregs and also enhanced their suppressive activity toward the proliferation of T effector cells.
25081641 Molecular dynamics studies showed that only GTP decreases the formation of the GBP1:PIM1 complex through an allosteric mechanism, outlining the rational for the identification of new compounds potentially able to revert resistance to paclitaxel.
25040935 PIM-1 is a key component of the senescence machinery that contributes to heterochromatin formation. PIM-1 is also a direct target of IL-6/STAT3 signaling and mediates cytokine-induced cellular senescence.
24799066 Blocking the activities of PIM kinases(PIM1, PIM2 and PIM3) could prevent pancreatic cancer development. PIM kinases(PIM1, PIM2 and PIM3) may be a novel target for cancer therapy
24771642 PIM1 overexpression is associated with prostate cancer.
24685144 Pro-survival Pim-1 is markedly downregulated in the female diabetic heart compared to the male diabetic heart.
24547709 Data indicate that serine/threonine-protein kinase PIM1 expression was noted in each case of chronic lymphocytic leukemia/small lymphocytic lymphoma (CLL/SLL).
24401608 Pim-1 plays a pivotal role in the protective effect of HPC for CPCs, and the promotion of the expression of Pim-1 in CPCs can as serve part of molecular therapeutic interventional strategies in the treatment of cardiomyopathy
24155393 demonstrate that PIM-1 activity is indeed required for HIV-1 reactivation in T cell lines and primary CD4 T cells. The presented results thus confirm that kinases are key contributors to HIV-1 latency control
24116137 Data indicate that four independent prognostic factors were identified for colon cancer patients: pim-1 expression in tumors, tumor stroma, tumor-adjacent mucosa, as well as tumor stage.
24044948 Senescence characteristics of human cardiac progenitor cells are ameliorated by Pim-1 kinase resulting in rejuvenation of phenotypic and functional properties.
24040307 Pim-1 kinase has a role in phosphorylating and stabilizing 130 kDa FLT3 and promoting aberrant STAT5 signaling in acute myeloid leukemia with FLT3 internal tandem duplication
23990052 Pim-1 kinase is upregulated by green tea polyphenols via PPARgamma-mediated mechanisms in vascular endothelial cells.
23974202 The importance of the ERG/PIM1 axis is further underscored by the poorer prognosis of acute myeloid leukemia highly expressing ERG and PIM1.
23936194 Data indicate that the inhibitor (SKI-O-068)exhibits a half maximum inhibitory concentration (IC50) of 123 (+/-14) nM and has an unusual binding mode with Pim1 kinase.
23898208 HIV-1 Tat upregulates the expression of pim-1 oncogene (PIM1) in human primary T cells
23814490 Pim-1 plays a pivotal role in several tumor-relevant signaling pathways and establish the functional relevance of Pim-1 in colon carcinoma.
23755147 Pim1 mutations arising in cancer show a decreased thermal and thermodynamic stability and a lower activation energy values for kinase activity.
23749639 our results identify eIF4B as a critical substrate of Pim kinases in mediating the activity of Abl oncogenes
23748345 Pim kinases phosphorylate Chk1 and regulate its functions in acute myeloid leukemia.
23565217 Our data suggest that Pim1 might contribute to progression rather than initiation in prostate neoplasia.
23360763 Data indicate that by altering the scaffold of CK2 inhibitors to obtain selective inhibitors of DYRK1A and PIM1.
23209281 PIM kinases promote the production of IFNgamma, the hallmark cytokine produced by Th1 cells.
23202547 Reintroduction of human Pim1- cDNA into Pim1-/-mouse aortic endothelial cell significantly restored wildtype adhesive characteristics.
23142699 PIM-1 is an estrogen receptor alpha target gene adds a novel potential mechanism by which estrogens can contribute to breast cancer cell proliferation and carcinogenesis.
23131564 nuclear localization of PIM1 is important for resistance of mouse aortic endothelial cells to rapamycin-mediated inhibition of proliferation.
23129228 Pim-1-mediated NKX3.1 stabilization may be important in maintaining normal cellular homeostasis in normal prostate epithelial cells, and may maintain basal NKX3.1 protein levels in prostate cancer cells.
23119061 Overexpression of osteopontin, alphavbeta3 and Pim-1 associated with prognostically important clinicopathologic variables in non-small cell lung cancer.
23010478 Calcium signaling in cardiomyocytes is augmented by expression of Pim-1 kinase.
22986532 Data indicate that androgen receptor (AR) phosphorylation by PIM1 at S213 impacts gene transcription and is highly prevalent in aggressive prostate cancer.
22840454 Findings suggest that Pim-1 overexpression contributes to nasopharyngeal carcinoma (NPC) proliferation and migration, and targeting Pim-1 may be a potential treatment for anti-Pim-1-expressed NPCs.
22720752 The C-terminus of human PIM-1 kinase isoform2, a serine/threonine kinase of the calcium/calmodulin-regulated kinase family, directly interacts with VDR through the receptor's DNA-binding domain.
22700982 TTP post-transcriptionally down-regulates Pim-1 expression and that the overexpression of TTP may contribute to tumor suppression in part by down-regulating Pim-1 expression.
22689995 results suggest that modulation of the degradation of Isu by the Pim1 protease is a regulatory mechanism serving to rapidly help balance the cell's need for critical iron-requiring processes under changing environmental conditions
22619278 Genetic modification of bone marrow cells with Pim-1 may serve as a therapeutic approach to promote recovery of myocardial structure in myocardial infarction.
22584579 As AR turnover has been previously shown to be critical for cell cycle progression in prostate cancer cells, PIM-1 kinase isoforms may promote prostate cancer cell growth, at least in part, through modulating AR activity via distinct mechanisms.
22574367 PIM-1 protein expression in prostate cancer tissue is closely related to the Gleason score, clinical stage and PSA recurrence.
22451912 Concurrent expression of BCL6 and PIM1 in lymphomas, is reported.
22441844 Asymmetric segregation of chromatids in cardiac progenitor cells is increased nearly two-fold with Pim-1 kinase overexpression, indicating that Pim-1 promotes self-renewal of stem cells.
22282239 Our study indicates that the expression of Pim kinases is physiologically related to DNA-PKcs and ATM in ECs.
22273698 Data show that IL-6 treatment increased expression of phosphorylation of signal transducer and activator of transcription 3 (STAT3) and Pim-1 kinase.
22261337 The data suggest that Pim-1 plays a crucial role in the regulation of NHEJ repair.
22193779 These experiments define a novel biological function of PIM-1 as a co-regulator of EGFR signaling.
21993851 Our findings demonstrate the clinical and therapeutic relevance of PIM1 in gastric cancers, and suggest that PIM1 represents a potential therapeutic target.
21974958 Pim-1 expression correlates with lymphocyte proliferation and activation.
21910584 PIM1-activated pPRAS40, AKT-activated pFOXO3a, and their complex formation with 14-3-3 could be key regulators of the radiation-induced radioresistance in NSCLC cells.
21860423 Pim1 kinase is required to maintain tumorigenicity in MYC-expressing prostate cancer cells.(1794-803)
21859846 Targeting cap-dependent translation blocks converging survival signals by AKT and PIM 1, 2 kinases in lymphoma
21743487 Data show that miR-33a has potential tumor suppressor activity, acting through inhibition of Pim-1.
21734463 study identified a conserved G-quadruplex forming sequence in the 3' untranslated region (UTR) of the proto-oncogene PIM1; reporter gene assay demonstrated that the PIM1 RNA G-quadruplex represses translation
21680901 RAGE activation accounts for many features of Vascular remodeling diseases including VSMC proliferation and resistance to apoptosis by the activation of STAT3/Pim1/NFAT axis.
21474815 Pim-1 downregulation contributes to the pathogenesis of diabetic cardiomyopathy; transfection with Pim-1 plasmid prevents high glucose-induced cardiomyocyte and cardiac progenitor cell apoptosis.
21382889 inhibition of the inappropriate activation of STAT3/Pim1 axis is a novel, specific, and attractive therapeutic strategy to reverse Pulmonary artery hypertension.
21262926 the role of Pim-1 in pancreatic ductal adenocarcinoma (PDAC) growth transformation and validate Pim-1 kinase as a potential molecular marker for mutated K-Ras activity.
21187157 inhibition of LY294002-induced apoptosis by androgen is a function of an androgen receptor-dependent genomic signaling pathway leading to increase in Bcl-xL expression as well as Pim-1-dependen pathway mediated via phosphorylation of Bad at ser75
21143989 Pim-1 may play a role in bladder cancer initiation and progression
21062737 a Pim-1 inhibitory p27(Kip1) peptide could be developed as an anti-cancer drug against prostate cancer.
20958956 Silencing of Pim expression reduces cell motility, while Pim overexpression enhances it, strongly suggesting that the observed effects of DHPCC-9 are dependent on Pim kinase activity.
20939820 A cell-based test system useful for rapid and inexpensive pre-screening of compounds capable of preventing Pim-mediated phosphorylation is discussed.
20811681 Pim-1 plays a central role in the occurrence and development of esophageal squamous cell carcinoma
20663873 Data show that Pim-1 is able to cooperate with Skp2 to signal S phase entry.
20639905 PIM1 may act as a sensor for ribosomal stress independently of or in concert with the known p53-dependent mechanisms.
20633028 Pasteurella multocida toxin induced expression of the serine/threonine kinase Pim-1 leading to subsequent threonine phosphorylation of SOCS-1.
20587610 Observational study of gene-disease association. (HuGE Navigator)
20544717 the results of survival rates analyzed by Kaplan-Meier curve revealed that patients with high Pim-1 mRNA and protein expressions had a poorer prognosis than those with the low Pim-1 expression
20237496 Observational study of gene-disease association. (HuGE Navigator)
20215828 Pim1 overexpression increases AR transcriptional activity in a ligand-dependent manner in prostate cancer cell lines, resulting in enhanced cell survival at castrate levels of androgen
20203306 Cardioprotective action of Pim-1 kinase includes preservation of mitochondrial integrity during cardiomyopathic challenge conditions.
20191609 PIM-1 could play important roles in the progression of CaP and may be an interesting target for CaP therapy.
20075333 Define a mechanistic basis for enhanced myocardial regeneration in transgenic mice overexpressing Pim-1 kinase.
20032391 The correlation of PIM-1 overexpression in gastric glands with formation of lymph node metastases and survival proposes a prognostic role in gastric cancer.
19911008 These findings provide a model in which Pim-1 phosphorylation of RelA/p65 at Ser276 allows defense against ubiquitin-mediated degradation and whereby exerts activation of NF-kappaB signalling.
19878356 Expression of PIM-1 in adipose tissue may be a useful marker of adipocytic differentiation and may be used in the differential diagnosis of adipocytic neoplasms.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19734423 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19688129 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19573080 Observational study of gene-disease association. (HuGE Navigator)
19568408 Pim-1 may be used as a novel predictive marker of radiation response in patients with squamocellular cancers of head and neck.
19345670 juxtamembrane domain of FLT3 in ETV6/FLT3 fusion protein is critical for cell proliferation and PIM-1 up-regulation.
19336552 Observational study of gene-disease association. (HuGE Navigator)
19266083 expression of Pim-1 & Pim-3 is induced in response reactivation in KSHV-infected cells; they are required for KSHV reactivation under these conditions; data indicate Pim-1 & Pim-3 contribute to viral reactivation by phosphorylating the KSHV LANA
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19152965 Pim-1, but not PI3K, plays a major role in IL-5-mediated antiapoptotic signaling in eosinophils.
19003546 PIM-1 and hK2 were expressed higher in prostate cancer than those in benign prostatic glandular hyperplasia and normal prostate tissues, the differences among which had statistic significance (P < 0.05).
18775810 JAK2 promotes cell survival by signaling through the Pim/BAD/BCL-xL pathway
18768389 IL-3 up-regulates the expression of the antiapoptotic proteins cIAP2, Mcl-1, and Bcl-X(L) and induces a rapid and sustained de novo expression of the serine/threonine kinase Pim1 that closely correlates with cytokine-enhanced survival.
18708761 Hypoxia-inducible proto-oncogene PIM1 is a prognostic marker in pancreatic ductal adenocarcinoma.
18695914 Down-regulation of pim-1 mRNA expression in non-small cell lung cancer is associated with lymph node metastases.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18596907 Pim-1 is overexpressed in immortalized, non-tumorigenic human prostate and mammary epithelial cells, these cells gradually converted to polyploidy and became tumorigenic
18593906 Pim kinases promote cell cycle progression and tumorigenesis by down-regulating p27(Kip1) expression at both transcriptional and posttranslational levels.
18519946 Nucleostemin expression in cardiomyocytes is induced by fibroblast growth factor-2 and accumulates in response to Pim-1 kinase activity.
18467333 Pim-1 induces the p53 pathway in cultured cells and correlate with increased Mdm2 in mantle cell lymphoma
18426800 PIM1 kinase plays a critical role in the STAT3 --> PIM1 --> NFkappaB stress response pathway
18426646 The over-expressions of HSP70 and pim-1 protein/mRNA are related to tumor burden in leukemia patients.
18216297 expression of the Myc and Pim proto-oncogenes by Jak2V617F was found to be FERM domain dependent.
18056989 Pim-1 kinase phosphorylates BCRP/ABCG2 and thereby promotes its multimerization and drug-resistant activity in human prostate cancer cells
18037896 Pim-1 is a crucial facet of cardioprotection downstream of Akt
17855660 Pim-1 overexpression may contribute to tumorigenesis in part by influencing the cellular localization and stability of p21 WAF1 and by promoting cell proliferation.
17643117 Results establish a new function for PIM1 as a MYC cofactor that phosphorylates the chromatin at MYC-target loci and suggest that nucleosome phosphorylation, at E boxes, contributes to MYC-dependent transcriptional activation and cellular transformation.
17560648 aberration in chromosome 6p21-23, where PIM gene is located, is not a random event in t(12;21) positive ALL
17487358 the functional role of Pim-1 in molecular processes of head and neck squamous cell carcinomas
17476282 PIM1 mutation is associated with splenic and nodal marginal zone B-cell lymphomas
17448597 PIM1 is upregulated after radical prostatectomy for prostatic neoplasms.
17327400 Pim1 appears to be a direct transcriptional target of HOXA9 and a mediator of its antiapoptotic and proproliferative effects in early cells
17313559 Expression of Pim-1 is both necessary and sufficient for polyploidization, but is not critical to cytoplasmic differentiation on megakaryopoiesis.
16712793 Pim-1 expression may be regulated by progesterone during mammary development and Pim-1 associates with p21 in mammary epithelial cells
16684349 results suggest that mammalian RUNX family transcription factors are novel binding partners and substrates for the Pim-1 kinase, which may be able to regulate their activities during normal hematopoiesis as well as in leukemogenesis
16647097 The role of LANA from Kaposi sarcoma-associated herpes virus on the upregulation of PIM-1 in B cells is reported.
16508102 The large crystals of apo Pim-1 enzyme diffracted to 2.1 A resolution and belong to space group P6(5), with unit-cell parameters a = b = 95.9, c = 80.0 A, beta = 120 degrees.
16403219 All three Pim kinase family members predominantly phosphorylate Bad on Ser112 and in addition are capable of phosphorylating Bad on multiple sites associated with the inhibition of the pro-apoptotic function of Bad in HEK-293 cells
16356754 Data suggest that Pim-1 activates Cdc25C by a direct phosphorylation and can thereby assume the function of a positive cell cycle regulator at the G2/M transition.
16266891 The PIM-1/RPS19 interaction was demonstrated both in vitro and in living cells and led to phosphorylation of RPS19 in an in vitro kinase assay.
16227208 analysis of Pim-1 kinase structure and substrate specificity
16221667 results indicated that chronic Pim-1 kinase overexpression dysregulates cyclin B1 protein expression, which contributes to the development of polyploidy by delaying cytokinesis
16186805 PIM1 gene encodes two isoforms by alternative translation initiation at a non-AUG (CUG) and AUG start codons. The two isoforms differ in preferential cellular localization, and may regulate distinct substrates.
15808862 Results describe the crystal structures of Pim1 in apo form and bound with AMPPNP.
15798097 Pim-1 kinase stability is regulated by heat shock proteins and the ubiquitin-proteasome pathway
15721354 EBV-induced upregulation of Pim kinases and Pim-stimulated EBNA2 transcriptional activity may contribute to the ability of EBV to immortalize B-cells and predispose them to malignant growth.
15657054 The structure of the LY294002/Pim-1 complex reveals a new binding mode that may be general for serine-threonine kinases.
15525646 crystal structures of apo Pim-1 kinase and its AMP-PNP (5'-adenylyl-beta,gamma-imidodiphosphate) complex to 2.1-angstroms resolutions
15471855 Pim-1 expression was observed in the neointima of balloon-injured rat carotid arteries and in human thoracic aortas and coronary arteries showing intimal thickening suggesting that Pim-1 plays a role in vascular smooth muscle proliferation
15319445 Data show that the protein kinase Cdc25 C-associated kinase 1 (C-TAK1) is a binding partner and a substrate of Pim-1, and suggest a role for Pim-1 as a positive regulator at the G(2)/M transition of the cell cycle.
15264249 PIM-1 overexpression in high-grade prostatic intraepithelial neoplasia (HGPIN) may be an early event in prostate malignancy development; PIM-1 expression provides supplementary information for distinguishing HGPIN from benign epithelium.
14981536 Pim1 and Etk are required for IL6-induced activation of androgen receptor-mediated transcription in prostate cancer.
13679438 Overexpression of Pim-1 may attenuate androgen response during progression of prostate cancer in a cell context-dependent fashion.
12680209 The nuclear location of Pim-1 is essential for its regulation of the levels of HDM2 protein.
12111331 plays a role, most likely by phosphorylation, in promoting complex formation between NuMA, HP1beta, dynein and dynactin, a complex that is necessary for mitosis
12036885 Upregulation by BCR/ABL requires activation of STAT5 and plays a key role in the BCR/ABL-mediated cell protection from apoptosis.

AA Sequence

MPHEPHEPLTPPFSALPDPAGAPSRRQSRQRPQLSSDSPSAFRASRSHSRNATRSHSHSHSPRHSLRHSP      1 - 70
GSGSCGSSSGHRPCADILEVGMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGF     71 - 140
GSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLI    141 - 210
LERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGS    211 - 280
GALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFFRQRV    281 - 350
SSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK                    351 - 404
//

Text Mined References (181)

PMID Year Title
26934497 2016 The PIM1 kinase promotes prostate cancer cell migration and adhesion via multiple signalling pathways.
26598507 2016 Pim1 kinase promotes angiogenesis through phosphorylation of endothelial nitric oxide synthase at Ser-633.
26555723 2015 Human CD180 Transmits Signals via the PIM-1L Kinase.
26551340 Patterns and Significance of PIM Kinases in Urothelial Carcinoma.
26472029 2015 The PIM inhibitor AZD1208 synergizes with ruxolitinib to induce apoptosis of ruxolitinib sensitive and resistant JAK2-V617F-driven cells and inhibit colony formation of primary MPN cells.
26453516 2015 Pim1 kinase activity preserves airway epithelial integrity upon house dust mite exposure.
26352175 2015 Downregulation of microRNA?33a promotes cyclin?dependent kinase 6, cyclin D1 and PIM1 expression and gastric cancer cell proliferation.
26202252 2015 Pim Kinase Interacts with Nonstructural 5A Protein and Regulates Hepatitis C Virus Entry.
26075720 2015 Pim Kinases Promote Migration and Metastatic Growth of Prostate Cancer Xenografts.
25882843 2015 Functional Effect of Pim1 Depends upon Intracellular Localization in Human Cardiac Progenitor Cells.
25834102 2015 PIM1 regulates glycolysis and promotes tumor progression in hepatocellular carcinoma.
25553374 2015 Understanding the functional discrepancy of Pim-1 in cancer.
25551195 2014 Pim-1 acts as an oncogene in human salivary gland adenoid cystic carcinoma.
25451079 2015 Regulation of prostate stromal fibroblasts by the PIM1 protein kinase.
25416956 2014 A proteome-scale map of the human interactome network.
25342548 2014 Pim-1 kinase is a target of miR-486-5p and eukaryotic translation initiation factor 4E, and plays a critical role in lung cancer.
25238262 2014 The PIM family of oncoproteins: small kinases with huge implications in myeloid leukemogenesis and as therapeutic targets.
25155357 2015 Pim1 kinase is upregulated in glioblastoma multiforme and mediates tumor cell survival.
25121590 2014 EBNA3C augments Pim-1 mediated phosphorylation and degradation of p21 to promote B-cell proliferation.
25104088 2014 MicroRNA-486-5p targeting PIM-1 suppresses cell proliferation in breast cancer cells.
25096571 2014 PIM1 kinase phosphorylates the human transcription factor FOXP3 at serine 422 to negatively regulate its activity under inflammation.
25081641 2015 GTP is an allosteric modulator of the interaction between the guanylate-binding protein 1 and the prosurvival kinase PIM1.
25040935 2014 PIM-1 modulates cellular senescence and links IL-6 signaling to heterochromatin formation.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24799066 2014 PIM kinases: an overview in tumors and recent advances in pancreatic cancer.
24771642 2014 RNAi screen identifies a synthetic lethal interaction between PIM1 overexpression and PLK1 inhibition.
24685144 2014 Rapid onset of cardiomyopathy in STZ-induced female diabetic mice involves the downregulation of pro-survival Pim-1.
24547709 2014 Expression of PIM1 protein in chronic lymphocytic leukemia/small lymphocytic lymphoma.
24401608 2014 Hypoxic preconditioning increases survival of cardiac progenitor cells via the pim-1 kinase-mediated anti-apoptotic effect.
24155393 2014 Kinase control of latent HIV-1 infection: PIM-1 kinase as a major contributor to HIV-1 reactivation.
24116137 2013 Expression of pim-1 in tumors, tumor stroma and tumor-adjacent mucosa co-determines the prognosis of colon cancer patients.
24044948 2013 Rejuvenation of human cardiac progenitor cells with Pim-1 kinase.
24040307 2013 Pim-1 kinase phosphorylates and stabilizes 130 kDa FLT3 and promotes aberrant STAT5 signaling in acute myeloid leukemia with FLT3 internal tandem duplication.
23990052 2013 Epigallocatechin-3-O-gallate, a green tea polyphenol, induces expression of pim-1 kinase via PPAR? in human vascular endothelial cells.
23974202 2013 Genome-scale expression and transcription factor binding profiles reveal therapeutic targets in transgenic ERG myeloid leukemia.
23936194 2013 Crystal structure of pim1 kinase in complex with a pyrido[4,3-d]pyrimidine derivative suggests a unique binding mode.
23814490 2013 Functional role and therapeutic potential of the pim-1 kinase in colon carcinoma.
23755147 2013 Effect of single amino acid substitution observed in cancer on Pim-1 kinase thermodynamic stability and structure.
23749639 2013 eIF4B phosphorylation by pim kinases plays a critical role in cellular transformation by Abl oncogenes.
23748345 2014 Pim kinases phosphorylate Chk1 and regulate its functions in acute myeloid leukemia.
23565217 2013 Conditional transgenic expression of PIM1 kinase in prostate induces inflammation-dependent neoplasia.
23360763 2013 Exploiting the repertoire of CK2 inhibitors to target DYRK and PIM kinases.
23209281 2013 Proviral integration site for Moloney murine leukemia virus (PIM) kinases promote human T helper 1 cell differentiation.
23202547 2012 Loss of pim1 imposes a hyperadhesive phenotype on endothelial cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23142699 2013 Proto-oncogene PIM-1 is a novel estrogen receptor target associating with high grade breast tumors.
23131564 2012 Nuclear PIM1 confers resistance to rapamycin-impaired endothelial proliferation.
23129228 2013 Stabilization of the prostate-specific tumor suppressor NKX3.1 by the oncogenic protein kinase Pim-1 in prostate cancer cells.
23119061 2012 Overexpression of osteopontin, ?v?3 and Pim-1 associated with prognostically important clinicopathologic variables in non-small cell lung cancer.
23010478 2012 Cardiac progenitor cells engineered with Pim-1 (CPCeP) develop cardiac phenotypic electrophysiological properties as they are co-cultured with neonatal myocytes.
22986532 2013 Phosphorylation of the androgen receptor by PIM1 in hormone refractory prostate cancer.
22840454 2012 Inhibition of Pim-1 attenuates the proliferation and migration in nasopharyngeal carcinoma cells.
22720752 2012 PIM-1 kinase interacts with the DNA binding domain of the vitamin D receptor: a further kinase implicated in 1,25-(OH)2D3 signaling.
22700982 2012 Expression of proviral integration site for Moloney murine leukemia virus 1 (Pim-1) is post-transcriptionally regulated by tristetraprolin in cancer cells.
22689995 2012 Cysteine desulfurase Nfs1 and Pim1 protease control levels of Isu, the Fe-S cluster biogenesis scaffold.
22619278 2012 Preservation of myocardial structure is enhanced by pim-1 engineering of bone marrow cells.
22584579 2012 Differential regulation of androgen receptor by PIM-1 kinases via phosphorylation-dependent recruitment of distinct ubiquitin E3 ligases.
22574367 2012 [Expression of PIM-1 in prostate cancer tissue and its relationship with PSA recurrence].
22451912 2012 PIM1 gene cooperates with human BCL6 gene to promote the development of lymphomas.
22441844 2012 Asymmetric chromatid segregation in cardiac progenitor cells is enhanced by Pim-1 kinase.
22282239 2012 PI3K-like kinases restrain Pim gene expression in endothelial cells.
22273698 2012 IL-6 stimulates STAT3 and Pim-1 kinase in pancreatic cancer cell lines.
22261337 2012 Pim-1 knockdown potentiates paclitaxel-induced apoptosis in human hormone-refractory prostate cancers through inhibition of NHEJ DNA repair.
22193779 2011 PIM kinase isoform specific regulation of MIG6 expression and EGFR signaling in prostate cancer cells.
21993851 2012 Clinical and therapeutic relevance of PIM1 kinase in gastric cancer.
21974958 2011 Anti-Pim-1 mAb inhibits activation and proliferation of T lymphocytes and prolongs mouse skin allograft survival.
21910584 2011 PIM1-activated PRAS40 regulates radioresistance in non-small cell lung cancer cells through interplay with FOXO3a, 14-3-3 and protein phosphatases.
21860423 2012 Pim1 kinase is required to maintain tumorigenicity in MYC-expressing prostate cancer cells.
21859846 2011 Targeting cap-dependent translation blocks converging survival signals by AKT and PIM kinases in lymphoma.
21743487 2012 The proto-oncogene Pim-1 is a target of miR-33a.
21734463 An RNA G-quadruplex in the 3' UTR of the proto-oncogene PIM1 represses translation.
21680901 2011 RAGE-dependent activation of the oncoprotein Pim1 plays a critical role in systemic vascular remodeling processes.
21474815 2011 Intravenous gene therapy with PIM-1 via a cardiotropic viral vector halts the progression of diabetic cardiomyopathy through promotion of prosurvival signaling.
21382889 2011 Signal transducers and activators of transcription-3/pim1 axis plays a critical role in the pathogenesis of human pulmonary arterial hypertension.
21262926 2011 The oncogenic kinase Pim-1 is modulated by K-Ras signaling and mediates transformed growth and radioresistance in human pancreatic ductal adenocarcinoma cells.
21187157 2011 Activation of a non-genomic Pim-1/Bad-Pser75 module is required for an efficient pro-survival effect of Bcl-xL induced by androgen in LNCaP cells.
21143989 2010 Overexpression of Pim-1 in bladder cancer.
21062737 2011 Cell-permeable carboxyl-terminal p27(Kip1) peptide exhibits anti-tumor activity by inhibiting Pim-1 kinase.
20958956 2010 Pim-selective inhibitor DHPCC-9 reveals Pim kinases as potent stimulators of cancer cell migration and invasion.
20939820 2010 Fighting tumor cell survival: advances in the design and evaluation of Pim inhibitors.
20811681 2010 A pivotal role for Pim-1 kinase in esophageal squamous cell carcinoma involving cell apoptosis induced by reducing Akt phosphorylation.
20663873 2010 Regulation of Skp2 levels by the Pim-1 protein kinase.
20639905 2010 PIM1 kinase is destabilized by ribosomal stress causing inhibition of cell cycle progression.
20633028 2010 Pasteurella multocida Toxin-induced Pim-1 expression disrupts suppressor of cytokine signalling (SOCS)-1 activity.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20544717 2010 Overexpression of Pim-1 is associated with poor prognosis in patients with esophageal squamous cell carcinoma.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20215828 2010 Pim1 regulates androgen-dependent survival signaling in prostate cancer cells.
20203306 2010 Pim-1 kinase protects mitochondrial integrity in cardiomyocytes.
20191609 2010 PIM-1 gene RNA interference induces growth inhibition and apoptosis of prostate cancer cells and suppresses tumor progression in vivo.
20075333 2010 Cardiac progenitor cell cycling stimulated by pim-1 kinase.
20032391 2009 Prognostic impact of protein overexpression of the proto-oncogene PIM-1 in gastric cancer.
19911008 2010 Pim-1 controls NF-kappaB signalling by stabilizing RelA/p65.
19878356 2010 PIM-1 kinase expression in adipocytic neoplasms: diagnostic and biological implications.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19749799 2009 PIM1 phosphorylates and negatively regulates ASK1-mediated apoptosis.
19734423 2009 Single nucleotide polymorphism genomic arrays analysis of t(8;21) acute myeloid leukemia cells.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19688129 2008 Association of single nucleotide polymorphisms in PIM-1 gene with the risk of Korean lung cancer.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19568408 2009 Pim-1 kinase expression predicts radiation response in squamocellular carcinoma of head and neck and is under the control of epidermal growth factor receptor.
19345670 2009 The juxtamembrane domain in ETV6/FLT3 is critical for PIM-1 up-regulation and cell proliferation.
19336552 2009 Risk of non-Hodgkin lymphoma associated with germline variation in genes that regulate the cell cycle, apoptosis, and lymphocyte development.
19266083 2009 KSHV reactivation from latency requires Pim-1 and Pim-3 kinases to inactivate the latency-associated nuclear antigen LANA.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19152965 2009 Proviral integration site for Moloney murine leukemia virus 1, but not phosphatidylinositol-3 kinase, is essential in the antiapoptotic signaling cascade initiated by IL-5 in eosinophils.
19003546 2009 Real-time quantitative RT-PCR assessment of PIM-1 and hK2 mRNA expression in benign prostate hyperplasia and prostate cancer.
18775810 2008 Effects of the JAK2 inhibitor, AZ960, on Pim/BAD/BCL-xL survival signaling in the human JAK2 V617F cell line SET-2.
18768389 2008 IL-3 induces a Pim1-dependent antiapoptotic pathway in primary human basophils.
18708761 2008 Hypoxia-inducible proto-oncogene Pim-1 is a prognostic marker in pancreatic ductal adenocarcinoma.
18695914 2008 Frequent down-regulation of pim-1 mRNA expression in non-small cell lung cancer is associated with lymph node metastases.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18596907 2008 A role for polyploidy in the tumorigenicity of Pim-1-expressing human prostate and mammary epithelial cells.
18593906 2008 Pim kinases promote cell cycle progression by phosphorylating and down-regulating p27Kip1 at the transcriptional and posttranscriptional levels.
18519946 2008 Myocardial induction of nucleostemin in response to postnatal growth and pathological challenge.
18467333 2008 Elevated levels of oncogenic protein kinase Pim-1 induce the p53 pathway in cultured cells and correlate with increased Mdm2 in mantle cell lymphoma.
18426800 2008 The PIM1 kinase is a critical component of a survival pathway activated by docetaxel and promotes survival of docetaxel-treated prostate cancer cells.
18426646 2008 [Expression characteristics of heat shock protein 70 and pim-1 gene in bone marrow mononuclear cells from leukemia patients and their clinical significance].
18216297 2008 The Jak2V617F oncogene associated with myeloproliferative diseases requires a functional FERM domain for transformation and for expression of the Myc and Pim proto-oncogenes.
18056989 2008 The 44-kDa Pim-1 kinase phosphorylates BCRP/ABCG2 and thereby promotes its multimerization and drug-resistant activity in human prostate cancer cells.
18037896 2007 Pim-1 regulates cardiomyocyte survival downstream of Akt.
17855660 2007 Pim-1 kinase-dependent phosphorylation of p21Cip1/WAF1 regulates its stability and cellular localization in H1299 cells.
17643117 2007 PIM1-dependent phosphorylation of histone H3 at serine 10 is required for MYC-dependent transcriptional activation and oncogenic transformation.
17560648 2007 Association of PIM gene translocation and TEL/AML1 rearrangement.
17487358 2007 Overexpression of Pim-1 in head and neck squamous cell carcinomas.
17476282 2007 Analysis of BCL-6, CD95, PIM1, RHO/TTF and PAX5 mutations in splenic and nodal marginal zone B-cell lymphomas suggests a particular B-cell origin.
17448597 2008 Marked gene transcript level alterations occur early during radical prostatectomy.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17327400 2007 Evidence that the Pim1 kinase gene is a direct target of HOXA9.
17313559 2007 Pim-1 induced polyploidy but did not affect megakaryocytic differentiation of K562 cells and CD34+ cells from cord blood.
16712793 2006 Pim-1 kinase expression during murine mammary development.
16684349 2006 Pim-1 kinase phosphorylates RUNX family transcription factors and enhances their activity.
16647097 2006 KSHV encoded LANA upregulates Pim-1 and is a substrate for its kinase activity.
16508102 2005 Expression, purification, crystallization and preliminary crystallographic analysis of human Pim-1 kinase.
16403219 2006 Pim kinases phosphorylate multiple sites on Bad and promote 14-3-3 binding and dissociation from Bcl-XL.
16356754 2006 The oncogenic serine/threonine kinase Pim-1 directly phosphorylates and activates the G2/M specific phosphatase Cdc25C.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16266891 2005 Interactions between RPS19, mutated in Diamond-Blackfan anemia, and the PIM-1 oncoprotein.
16227208 2005 Structure and substrate specificity of the Pim-1 kinase.
16221667 2005 Chromosomal instability induced by Pim-1 is passage-dependent and associated with dysregulation of cyclin B1.
16186805 2006 The 44 kDa Pim-1 kinase directly interacts with tyrosine kinase Etk/BMX and protects human prostate cancer cells from apoptosis induced by chemotherapeutic drugs.
15808862 2005 Crystal structures of proto-oncogene kinase Pim1: a target of aberrant somatic hypermutations in diffuse large cell lymphoma.
15798097 2005 Pim-1 kinase stability is regulated by heat shock proteins and the ubiquitin-proteasome pathway.
15721354 2005 Pim kinases are upregulated during Epstein-Barr virus infection and enhance EBNA2 activity.
15657054 2005 Pim-1 ligand-bound structures reveal the mechanism of serine/threonine kinase inhibition by LY294002.
15528381 2004 IL-5 and granulocyte-macrophage colony-stimulating factor activate STAT3 and STAT5 and promote Pim-1 and cyclin D3 protein expression in human eosinophils.
15525646 2005 Structural basis of constitutive activity and a unique nucleotide binding mode of human Pim-1 kinase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15471855 2004 Role of pim-1 in smooth muscle cell proliferation.
15319445 2004 The oncogenic serine/threonine kinase Pim-1 phosphorylates and inhibits the activity of Cdc25C-associated kinase 1 (C-TAK1): a novel role for Pim-1 at the G2/M cell cycle checkpoint.
15264249 2004 Pim-1 expression in prostatic intraepithelial neoplasia and human prostate cancer.
14981536 2004 Synergism of cytoplasmic kinases in IL6-induced ligand-independent activation of androgen receptor in prostate cancer cells.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
13679438 2003 Attenuation of androgen receptor-dependent transcription by the serine/threonine kinase Pim-1.
12680209 Pim-1 protein kinase is nuclear in Burkitt's lymphoma: nuclear localization is necessary for its biologic effects.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12473674 2003 Protein phosphatase 2A regulates the stability of Pim protein kinases.
12431783 2002 Phosphorylation of the cell cycle inhibitor p21Cip1/WAF1 by Pim-1 kinase.
12411508 2002 Regulation of G(2)/M events by Cdc25A through phosphorylation-dependent modulation of its stability.
12111331 2002 Pim-1 associates with protein complexes necessary for mitosis.
12036885 2002 Complementary functions of the antiapoptotic protein A1 and serine/threonine kinase pim-1 in the BCR/ABL-mediated leukemogenesis.
11823475 2002 Cutting edge: Transcriptional activity of NFATc1 is enhanced by the Pim-1 kinase.
11591366 2001 Pim-1 translocates sorting nexin 6/TRAF4-associated factor 2 from cytoplasm to nucleus.
11518967 2001 Delineation of prognostic biomarkers in prostate cancer.
11460166 2001 Hypermutation of multiple proto-oncogenes in B-cell diffuse large-cell lymphomas.
11368509 2001 Pim-1 negatively regulates the activity of PTP-U2S phosphatase and influences terminal differentiation and apoptosis of monoblastoid leukemia cells.
11279102 2001 Sorting nexin 6, a novel SNX, interacts with the transforming growth factor-beta family of receptor serine-threonine kinases.
11237709 2001 Regulation of Pim-1 by Hsp90.
10931201 2000 PAP-1, a novel target protein of phosphorylation by pim-1 kinase.
10664448 2000 Identification of heterochromatin protein 1 (HP1) as a phosphorylation target by Pim-1 kinase and the effect of phosphorylation on the transcriptional repression function of HP1(1).
10373478 1999 Physical and functional interactions between Pim-1 kinase and Cdc25A phosphatase. Implications for the Pim-1-mediated activation of the c-Myc signaling pathway.
9809063 1998 Pim-1 kinase and p100 cooperate to enhance c-Myb activity.
3475233 1987 The cDNA sequence and gene analysis of the human pim oncogene.
3429489 1987 Cloning and characterization of the human PIM-1 gene: a putative oncogene related to the protein kinases.
3329709 1987 Comparison of the human and mouse PIM-1 cDNAs: nucleotide sequence and immunological identification of the in vitro synthesized PIM-1 protein.
2837645 1988 Identification of the human pim-1 gene product as a 33-kilodalton cytoplasmic protein with tyrosine kinase activity.
2682662 1989 The human protooncogene product p33pim is expressed during fetal hematopoiesis and in diverse leukemias.
2205533 1990 Primary structure of the putative human oncogene, pim-1.
1825810 1991 The pim-1 oncogene encodes two related protein-serine/threonine kinases by alternative initiation at AUG and CUG.
1427894 1992 A testis-expressed Zn finger gene (ZNF76) in human 6p21.3 centromeric to the MHC is closely linked to the human homolog of the t-complex gene tcp-11.