Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.83
PubTator Score 5.32

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MGRPLLLPLLLLLQPPAFLQPGGSTGSGPSYLYGVTQPKHLSASMGGSVEIPFSFYYPWELAIVPNVRIS      1 - 70
WRRGHFHGQSFYSTRPPSIHKDYVNRLFLNWTEGQESGFLRISNLRKEDQSVYFCRVELDTRRSGRQQLQ     71 - 140
SIKGTKLTITQAVTTTTTWRPSSTTTIAGLRVTESKGHSESWHLSLDTAIRVALAVAVLKTVILGLLCLL    141 - 210
LLWWRRRKGSRAPSSDF                                                         211 - 227
//

Text Mined References (14)

PMID Year Title