Property Summary

NCBI Gene PubMed Count 54
PubMed Score 154.89
PubTator Score 80.25

Knowledge Summary

Patent (7,212)

Expression

  Differential Expression (7)

 GWAS Trait (1)

Gene RIF (36)

PMID Text
26405034 data identify a novel role of the ArPIKfyve-Sac3 complex in the mechanisms controlling aggregate formation of Sph1 and suggest that Sac3 protein deficiency or overproduction may facilitate aggregation of aggregation-prone proteins
26396486 A novel heterozygous frameshift mutation (c.3151dupA) and a copy number variations in PIKFYVE gene have been found in two unrelated Fleck corneal dystrophy patients.
26216398 The PIKfyve complex is required for APP trafficking, suggesting a feedback loop in which APP, by binding to and stimulating phosphatidylinositol-3,5-bisphosphate vesicle formation may control its own trafficking.
26125944 APP functionally cooperates with PIKfyve in vivo. This regulation is required for maintaining endosomal and neuronal function.
24840251 Data suggest PIKFYVE, MTMR3 (myotubularin related protein 3) and their product phosphatidylinositol 5-phosphate are involved in activation of RAC1 (rho family small GTP binding protein); this process regulates migration/invasion of carcinoma/sarcoma.
24600036 Data indicate that pharmacological or genetic inactivation of PIKfyve rapidly induces expression of the transcription repressor ATF3, which is necessary and sufficient for suppression of type I IFN expression.
23757022 Data indicate that AKT promotes EGFR recycling by phosphorylating and activating PIKfyve.
23297396 PIP5Kalpha promotes TLR4-associated microglial inflammation by mediating PIP(2)-dependent recruitment of TIRAP to the plasma membrane
23188060 the present observations show that PKB in conjunction with PIKfyve activates Kir2.1 channels.
23178941 Overexpression of phosphatidylinositol 4 phosphate 5-kinase (PIP5K) suppresses HIV-1 Tat-mediated inhibition of growth hormone secretion from cells
23154468 Production of phosphatidylinositol 5-phosphate via PIKfyve and MTMR3 regulates cell migration.
22621786 The results provide the first experimental evidence that the principal pathway for PtdIns5P intracellular production is through PIKfyve.
22065932 A novel c.3060-3063 delCCTT (p.P968Vfs23) mutation in the PIKFYVE gene has been described in a five generation Greek family, which segregated with the fleck corneal dystrophy.
20945365 The recent advances in Arf6/PIP5K signaling and its linkage to cellular functions, are reviewed.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20041238 Data conclude that PIKfyve participates in the regulation of TRPV6.
19910676 Coexpression of PIKfyve is followed by a marked increase of glutamate induced currents in EAAT2 expressing oocytes.
19852935 these results demonstrate that PIKfyve regulates CFTR activity, and suggest a novel mechanism of CFTR regulation.
19841139 PIKfyve-dependent channel degradation is essential to prevent Ca2+-induced toxicity in neurons.
19840946 PIKfyve-ArPIKfyve-Sac3 core complex: contact sites and their consequence for Sac3 phosphatase activity and endocytic membrane homeostasis
19582903 Results suggest that PIKfyve inhibition may render the late endosome/lysosome compartment refractory to fusion with both autophagosomes and with EGFR-containing multivesicular bodies.
19232516 PIKfyve is a potent stimulator of ClC-2-activity and contributes to SGK1-dependent regulation of ClC-2.
19056739 Kinesin adapter JLP links PIKfyve to microtubule-based endosome-to-trans-Golgi network traffic of furin.
18950639 The authors data indicate that the PAS complex is organized to provide optimal PIKfyve functionality and is maintained via ArPIKfyve homomeric and heteromeric interactions.
18774718 A phylogenetic study revealing co-evolution of phosphoinositides kinases and phosphatases ; PIKFYVE is absent from several organisms and co-evolved with VAC14 and FIG4
18501703 These data suggest for the first time a role of PtdIns5P and PIKfyve in oncogenesis, potentially linking intracellular trafficking to cancer.
18429927 REVIEW : PIKFYVE and other phosphoinositides regulatory proteins are implicated in human genetic diseases
17570343 The observations disclose that PIKfyve participates in the SGK1-dependent regulation of SLC5A1.
17146146 results suggest that the local production of PtdIns(3)P implicates the fusion of macropinosomes via EEA1 as well as conventional early endosomes
16954148 PIKfyve regulates endosome-to-TGN retrograde transport.
16801682 The first multicellular model for PIKFYVE loss, pointing to a role in lysosome maturation
16448788 PIKfyve is distributed in microdomains that are distinct from those occupied by EEA1 and Hrs
15902656 Linkage analysis localized CFD to a 24-cM (18-Mb) interval of chromosome 2q35 flanked by D2S2289 and D2S126 and containing PIP5K3.
15542851 the PIKfyve-associated hVac14 protein has a major role in activating PIKfyve and thereby regulating PtdIns(3,5)P(2) synthesis and endomembrane homeostasis in mammalian cells
14551253 PIKfyve selectively regulates the sorting and traffic of peripheral endosomes containing lysosomaly directed fluid phase cargo through controlling the morphogenesis and function of multivesicular bodies
14530284 p40 interaction with PIKfyve p40 os demonstrated; PIKfyve interaction and the subsequent PIKfyve-catalyzed p40 phosphorylation anchor p40 to discrete membranes facilitating late endosome-to-TGN transport.

AA Sequence

MATDDKTSPTLDSANDLPRSPTSPSHLTHFKPLTPDQDEPPFKSAYSSFVNLFRFNKERAEGGQGEQQPL      1 - 70
SGSWTSPQLPSRTQSVRSPTPYKKQLNEELQRRSSALDTRRKAEPTFGGHDPRTAVQLRSLSTVLKRLKE     71 - 140
IMEGKSQDSDLKQYWMPDSQCKECYDCSEKFTTFRRRHHCRLCGQIFCSRCCNQEIPGKFMGYTGDLRAC    141 - 210
TYCRKIALSYAHSTDSNSIGEDLNALSDSACSVSVLDPSEPRTPVGSRKASRNIFLEDDLAWQSLIHPDS    211 - 280
SNTPLSTRLVSVQEDAGKSPARNRSASITNLSLDRSGSPMVPSYETSVSPQANRTYVRTETTEDERKILL    281 - 350
DSVQLKDLWKKICHHSSGMEFQDHRYWLRTHPNCIVGKELVNWLIRNGHIATRAQAIAIGQAMVDGRWLD    351 - 420
CVSHHDQLFRDEYALYRPLQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQIAEEGDDNLAN    421 - 490
SASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFHIKKPSKYPHVPPHPADQKEYLISDTGGQQLSIS    491 - 560
DAFIKESLFNRRVEEKSKELPFTPLGWHHNNLELLREENGEKQAMERLLSANHNHMMALLQQLLHSDSLS    561 - 630
SSWRDIIVSLVCQVVQTVRPDVKNQDDDMDIRQFVHIKKIPGGKKFDSVVVNGFVCTKNIAHKKMSSCIK    631 - 700
NPKILLLKCSIEYLYREETKFTCIDPIVLQEREFLKNYVQRIVDVRPTLVLVEKTVSRIAQDMLLEHGIT    701 - 770
LVINVKSQVLERISRMTQGDLVMSMDQLLTKPHLGTCHKFYMQIFQLPNEQTKTLMFFEGCPQHLGCTIK    771 - 840
LRGGSDYELARVKEILIFMICVAYHSQLEISFLMDEFAMPPTLMQNPSFHSLIEGRGHEGAVQEQYGGGS    841 - 910
IPWDPDIPPESLPCDDSSLLELRIVFEKGEQENKNLPQAVASVKHQEHSTTACPAGLPCAFFAPVPESLL    911 - 980
PLPVDDQQDALGSEQPETLQQTVVLQDPKSQIRAFRDPLQDDTGLYVTEEVTSSEDKRKTYSLAFKQELK    981 - 1050
DVILCISPVITFREPFLLTEKGMRCSTRDYFAEQVYWSPLLNKEFKEMENRRKKQLLRDLSGLQGMNGSI   1051 - 1120
QAKSIQVLPSHELVSTRIAEHLGDSQSLGRMLADYRARGGRIQPKNSDPFAHSKDASSTSSGQSGSKNEG   1121 - 1190
DEERGLILSDAVWSTKVDCLNPINHQRLCVLFSSSSAQSSNAPSACVSPWIVTMEFYGKNDLTLGIFLER   1191 - 1260
YCFRPSYQCPSMFCDTPMVHHIRRFVHGQGCVQIILKELDSPVPGYQHTILTYSWCRICKQVTPVVALSN   1261 - 1330
ESWSMSFAKYLELRFYGHQYTRRANAEPCGHSIHHDYHQYFSYNQMVASFSYSPIRLLEVCVPLPKIFIK   1331 - 1400
RQAPLKVSLLQDLKDFFQKVSQVYVAIDERLASLKTDTFSKTREEKMEDIFAQKEMEEGEFKNWIEKMQA   1401 - 1470
RLMSSSVDTPQQLQSVFESLIAKKQSLCEVLQAWNNRLQDLFQQEKGRKRPSVPPSPGRLRQGEESKISA   1471 - 1540
MDASPRNISPGLQNGEKEDRFLTTLSSQSSTSSTHLQLPTPPEVMSEQSVGGPPELDTASSSEDVFDGHL   1541 - 1610
LGSTDSQVKEKSTMKAIFANLLPGNSYNPIPFPFDPDKHYLMYEHERVPIAVCEKEPSSIIAFALSCKEY   1611 - 1680
RNALEELSKATQWNSAEEGLPTNSTSDSRPKSSSPIRLPEMSGGQTNRTTETEPQPTKKASGMLSFFRGT   1681 - 1750
AGKSPDLSSQKRETLRGADSAYYQVGQTGKEGTENQGVEPQDEVDGGDTQKKQLINPHVELQFSDANAKF   1751 - 1820
YCRLYYAGEFHKMREVILDSSEEDFIRSLSHSSPWQARGGKSGAAFYATEDDRFILKQMPRLEVQSFLDF   1821 - 1890
APHYFNYITNAVQQKRPTALAKILGVYRIGYKNSQNNTEKKLDLLVMENLFYGRKMAQVFDLKGSLRNRN   1891 - 1960
VKTDTGKESCDVVLLDENLLKMVRDNPLYIRSHSKAVLRTSIHSDSHFLSSHLIIDYSLLVGRDDTSNEL   1961 - 2030
VVGIIDYIRTFTWDKKLEMVVKSTGILGGQGKMPTVVSPELYRTRFCEAMDKYFLMVPDHWTGLGLNC     2031 - 2098
//

Text Mined References (63)

PMID Year Title
26405034 2015 The Protein Complex of Neurodegeneration-related Phosphoinositide Phosphatase Sac3 and ArPIKfyve Binds the Lewy Body-associated Synphilin-1, Preventing Its Aggregation.
26396486 2015 Identification of novel PIKFYVE gene mutations associated with Fleck corneal dystrophy.
26216398 2016 APP controls the formation of PI(3,5)P(2) vesicles through its binding of the PIKfyve complex.
26125944 2015 The Amyloid Precursor Protein Controls PIKfyve Function.
25578879 2015 PI(5)P regulates autophagosome biogenesis.
25416956 2014 A proteome-scale map of the human interactome network.
24840251 2014 PIKfyve, MTMR3 and their product PtdIns5P regulate cancer cell migration and invasion through activation of Rac1.
24600036 2014 PIKfyve, a class III lipid kinase, is required for TLR-induced type I IFN production via modulation of ATF3.
23757022 2013 AKT facilitates EGFR trafficking and degradation by phosphorylating and activating PIKfyve.
23297396 2013 Phosphatidylinositol 4-phosphate 5-kinase ? facilitates Toll-like receptor 4-mediated microglial inflammation through regulation of the Toll/interleukin-1 receptor domain-containing adaptor protein (TIRAP) location.
23188060 2013 Up-regulation of the inwardly rectifying K? channel Kir2.1 (KCNJ2) by protein kinase B (PKB/Akt) and PIKfyve.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23154468 2013 Production of phosphatidylinositol 5-phosphate via PIKfyve and MTMR3 regulates cell migration.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22621786 2012 Functional dissociation between PIKfyve-synthesized PtdIns5P and PtdIns(3,5)P2 by means of the PIKfyve inhibitor YM201636.
22065932 2011 A novel PIKFYVE mutation in fleck corneal dystrophy.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20945365 2011 Regulation of PIP5K activity by Arf6 and its physiological significance.
20513353 2010 Regulation of PIKfyve phosphorylation by insulin and osmotic stress.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20193073 2010 Chaperonin genes on the rise: new divergent classes and intense duplication in human and other vertebrate genomes.
20041238 2010 Regulation of the Ca(2+) channel TRPV6 by the kinases SGK1, PKB/Akt, and PIKfyve.
19910676 2009 Regulation of the glutamate transporter EAAT2 by PIKfyve.
19852935 2009 PIKfyve upregulates CFTR activity.
19841139 2009 PIKfyve regulates CaV1.2 degradation and prevents excitotoxic cell death.
19840946 2009 PIKfyve-ArPIKfyve-Sac3 core complex: contact sites and their consequence for Sac3 phosphatase activity and endocytic membrane homeostasis.
19582903 2009 PIKfyve regulation of endosome-linked pathways.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19232516 2009 PIKfyve-dependent regulation of the Cl- channel ClC-2.
19056739 2009 Kinesin adapter JLP links PIKfyve to microtubule-based endosome-to-trans-Golgi network traffic of furin.
19037259 2008 VAC14 nucleates a protein complex essential for the acute interconversion of PI3P and PI(3,5)P(2) in yeast and mouse.
18950639 2008 ArPIKfyve homomeric and heteromeric interactions scaffold PIKfyve and Sac3 in a complex to promote PIKfyve activity and functionality.
18774718 2008 PtdIns5P regulation through evolution: roles in membrane trafficking?
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18501703 2008 Elevated levels of PtdIns5P in NPM-ALK transformed cells: implication of PIKfyve.
18429927 2008 Endosomal phosphoinositides and human diseases.
18304842 2008 PIKfyve: Partners, significance, debates and paradoxes.
17909029 2007 The phosphoinositide kinase PIKfyve mediates epidermal growth factor receptor trafficking to the nucleus.
17570343 2007 Regulation of the Na(+), glucose cotransporter by PIKfyve and the serum and glucocorticoid inducible kinase SGK1.
17556371 2007 Core protein machinery for mammalian phosphatidylinositol 3,5-bisphosphate synthesis and turnover that regulates the progression of endosomal transport. Novel Sac phosphatase joins the ArPIKfyve-PIKfyve complex.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17146146 2006 Effect of 3-methyladenine on the fusion process of macropinosomes in EGF-stimulated A431 cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16954148 2006 The mammalian phosphatidylinositol 3-phosphate 5-kinase (PIKfyve) regulates endosome-to-TGN retrograde transport.
16801682 2006 The phosphoinositide kinase PIKfyve/Fab1p regulates terminal lysosome maturation in Caenorhabditis elegans.
16448788 2006 Cloning and subcellular localization of a human phosphatidylinositol 3-phosphate 5-kinase, PIKfyve/Fab1.
15902656 2005 Mutations in PIP5K3 are associated with François-Neetens mouchetée fleck corneal dystrophy.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15542851 2004 A mammalian ortholog of Saccharomyces cerevisiae Vac14 that associates with and up-regulates PIKfyve phosphoinositide 5-kinase activity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
15046600 2004 Btk-dependent regulation of phosphoinositide synthesis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14551253 2003 PIKfyve controls fluid phase endocytosis but not recycling/degradation of endocytosed receptors or sorting of procathepsin D by regulating multivesicular body morphogenesis.
14530284 2003 Active PIKfyve associates with and promotes the membrane attachment of the late endosome-to-trans-Golgi network transport factor Rab9 effector p40.
12607114 2003 Genetic linkage of Francois-Neetens fleck (mouchetée) corneal dystrophy to chromosome 2q35.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12270933 2002 Phosphatidylinositol 5-phosphate biosynthesis is linked to PIKfyve and is involved in osmotic response pathway in mammalian cells.
11714711 2002 Functional dissection of lipid and protein kinase signals of PIKfyve reveals the role of PtdIns 3,5-P2 production for endomembrane integrity.
11706043 2002 Phosphatidylinositol 3-phosphate-interacting domains in PIKfyve. Binding specificity and role in PIKfyve. Endomenbrane localization.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.