Property Summary

NCBI Gene PubMed Count 15
PubMed Score 8.08
PubTator Score 9.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -3.400 1.0e-07
osteosarcoma 1.015 2.2e-02
non diabetic and post-ischemic heart fai... 1.200 4.7e-03
medulloblastoma, large-cell -1.500 4.2e-05
lung cancer -2.400 1.6e-05
atypical teratoid/rhabdoid tumor -1.100 2.8e-05
group 3 medulloblastoma -1.300 8.8e-04
lung adenocarcinoma -1.400 7.2e-09
ovarian cancer -1.300 1.4e-05

Gene RIF (4)

PMID Text
22706993 These results suggest that the novel PI3K regulator PIK3IP1 plays an inhibitory role in T-cell activation.
19088825 PIK3IP1-v1 is a novel splicing isoform of PIK3IP1. Both of them are located on cell membrane and can induce cell apoptosis.
18632611 PIK3IP1 is an important regulator of PI3K in vivo, and its dysregulation can contribute to liver carcinogenesis
17475214 PIK3IP1 directly binds to the p110 catalytic subunit and down modulates PI3K activity. Suggested that PIK3IP1 is a new type of PI3K regulator.

AA Sequence

MLLAWVQAFLVSNMLLAEAYGSGGCFWDNGHLYREDQTSPAPGLRCLNWLDAQSGLASAPVSGAGNHSYC      1 - 70
RNPDEDPRGPWCYVSGEAGVPEKRPCEDLRCPETTSQALPAFTTEIQEASEGPGADEVQVFAPANALPAR     71 - 140
SEAAAVQPVIGISQRVRMNSKEKKDLGTLGYVLGITMMVIIIAIGAGIILGYSYKRGKDLKEQHDQKVCE    141 - 210
REMQRITLPLSAFTNPTCEIVDEKTVVVHTSQTPVDPQEGTTPLMGQAGTPGA                     211 - 263
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22706993 2012 Inhibition of T-cell activation by PIK3IP1.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
19088825 2008 [Both PIK3IP1 and its novel found splicing isoform, PIK3IP1-v1, are located on cell membrane and induce cell apoptosis].
18632611 2008 PIK3IP1, a negative regulator of PI3K, suppresses the development of hepatocellular carcinoma.
17475214 2007 PI3K is negatively regulated by PIK3IP1, a novel p110 interacting protein.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12529303 2003 Reevaluating human gene annotation: a second-generation analysis of chromosome 22.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.