Property Summary

Ligand Count 379
NCBI Gene PubMed Count 368
PubMed Score 579.45
PubTator Score 182.59

Knowledge Summary

Patent (17,196)

Expression

  Differential Expression (13)

Disease log2 FC p
lung cancer -1.500 3.5e-03
adult high grade glioma 1.200 7.1e-03
Astrocytoma, Pilocytic 1.600 1.4e-06
interstitial cystitis 1.400 1.0e-02
invasive ductal carcinoma 1.129 1.0e-04
lung carcinoma -2.100 7.8e-26
non-small cell lung cancer -1.197 5.0e-09
osteosarcoma -2.193 2.6e-03
ovarian cancer -1.400 2.2e-04
periodontitis 1.100 4.5e-20
primary Sjogren syndrome 2.100 1.5e-04
subependymal giant cell astrocytoma 2.595 3.7e-03
ulcerative colitis 1.700 6.7e-04

Protein-protein Interaction (1)

PDB (89)

Gene RIF (354)

AA Sequence

MELENYKQPVVLREDNCRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRKCKSPETALLHVAGHGNVEQM      1 - 70
KAQVWLRALETSVAADFYHRLGPHHFLLLYQKKGQWYEIYDKYQVVQTLDCLRYWKATHRSPGQIHLVQR     71 - 140
HPPSEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGLVTPRMAEVASRDPKLYAMHPWVTSKPLPEY    141 - 210
LWKKIANNCIFIVIHRSTTSQTIKVSPDDTPGAILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEY    211 - 280
LVGETPIKNFQWVRHCLKNGEEIHVVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVF    281 - 350
TVSLWDCDRKFRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKI    351 - 420
KDLPKGALLNLQIYCGKAPALSSKASAESPSSESKGKVQLLYYVNLLLIDHRFLLRRGEYVLHMWQISGK    421 - 490
GEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEGDRVRAEMPNQLRKQLEAIIA    491 - 560
TDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQQEIVAKTYQLLARREVWDQSALDVGLTMQL    561 - 630
LDCNFSDENVRAIAVQKLESLEDDDVLHYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLR    631 - 700
SEIAQSRHYQQRFAVILEAYLRGCGTAMLHDFTQQVQVIEMLQKVTLDIKSLSAEKYDVSSQVISQLKQK    701 - 770
LENLQNSQLPESFRVPYDPGLKAGALAIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQ    771 - 840
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTGAFKDEVLNHW    841 - 910
LKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNLFHIDFGHILGNYKSFLGINK    911 - 980
ERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEY    981 - 1050
IRDALTVGKNEEDAKKYFLDQIEVCRDKGWTVQFNWFLHLVLGIKQGEKHSA                     1051 - 1102
//

Text Mined References (371)

PMID Year Title