Property Summary

NCBI Gene PubMed Count 80
PubMed Score 640.35
PubTator Score 2885.84

Knowledge Summary

Patent (6,395)

Expression

  Differential Expression (14)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.545 1.2e-02
malignant mesothelioma -1.500 4.6e-07
cutaneous lupus erythematosus 1.800 1.3e-03
osteosarcoma -3.801 1.8e-06
cystic fibrosis 1.245 2.0e-03
medulloblastoma, large-cell -1.600 8.6e-04
juvenile dermatomyositis -1.262 1.8e-10
lung cancer -2.800 2.9e-06
interstitial cystitis 1.600 1.1e-03
primary Sjogren syndrome 1.700 1.2e-03
subependymal giant cell astrocytoma 1.162 2.0e-02
gastric carcinoma 1.100 3.1e-02
ulcerative colitis 2.000 1.9e-05
ovarian cancer -1.600 3.8e-10

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (98)

PMID Text
26770665 Impaired signaling and protein synthesis through the PI3K catalytic subunit p110delta is an underlying molecular defect and potential treatment target in select autism spectrum disorders.
26540567 Bone marrow stroma-induced resistance of chronic lymphocytic leukemia cells to arsenic trioxide involves Mcl-1 upregulation and is overcome by inhibiting the PI3Kdelta or PKCbeta signaling pathways.
26437962 study concludes that activating mutations in PIK3CD may cause immunodeficiency in patients with a complex phenotype combining defective B and T cell responses, but are less likely to be discovered in patients where only the humoral arm of the immune response is affected and naive T cell numbers are normal
26286043 Studies indicate that phosphatidylinositol-45-bisphosphate 3-kinase 110 kDa catalytic subunit (PIK3CD p110delta) have been described (N334K, C416R, E525K and E1021K with the majority of cases carrying E1021K) as a cause for primary immunodeficiency.
26270987 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
26265781 Combined PI3K/Akt and Hsp90 targeting synergistically suppresses essential functions of alloreactive T cells and increases Tregs.
26251180 work identifies FAK as a target of p110delta PI3K that links RhoA with PTEN and establishes for the first time that PTEN is a substrate of FAK-mediated Tyr phosphorylation
26075907 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
25632006 Expression of functional S1PR1 is reduced by B cell receptor signaling and increased by inhibition of PIK3CD but not SYK or BTK in chronic lymphocytic leukemia cells.
25469863 Data indicate a series of quinolinylpurines as potent and selective PI3Kdelta kinase inhibitors with in vivo efficacy as measured by two rodent disease models of inflammation and autoimmune disease.
25352054 We describe a family of two adults and three children with a gain of function mutation in PIK3CD, all with recurrent sinopulmonary infections and varied infectious and non-infectious complications. Sequencing of PIK3CD confirmed a known heterozygous mutation c3061G>A, p.E1021K in all affected family members. The two adults have primary sclerosing cholangitis without C. parvum infection.
25104021 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
24716596 These results collectively indicate that inducible PI3Kdelta plays a crucial role in persistent activation of PI3K-Akt in fibroblast-like synoviocytes, and in the formation of a hypertrophic synovial lining.
24698326 Patients with activated phosphoinositide 3-kinase delta syndrome (mutation in PIK3CD) develop B-cell lymphomas.
24648465 The p110delta PI3K-selective compound CAL-101 (Idelalisib) did not inhibit markers of PI3K activity in cancer or stromal cells.
24610295 Mutations in PIK3CD can cause hyper IgM syndrome (HIGM) associated with increased cancer susceptibility.
24553178 PI3K p110delta uniquely promotes gain-of-function Shp2-induced GM-CSF hypersensitivity in a model of juvenile myelomonocytic leukemia.
24549598 Gestational diabetes mellitus is accompanied by leukocyte PIK3CD overexpression associated with reduced plasma LDL-C and TC levels, as well as with hyperglycaemia and elevated leukocyte SIRT1 mRNA.
24523440 PIK3CD was inversely correlated with miR-663 in glioblastoma specimens and predicted poor prognosis of patients with glioblastoma
24517182 PIK3CD is a target gene of miR-125b in Ewing's sarcoma cells. RT-PCR and western blot assays identify over-expression of miR-125b that suppresses the expression of PIK3CD mRNA and protein.
24470496 PI3Kdelta contributes to multiple aspects of the pathogenic FLS behavior in RA. These observations, together with previous findings that PI3Kdelta regulates FLS growth and survival
24293274 Study reveals functional and mechanistic links between miRNA-30b and oncogene KRAS, PIK3CD and BCL2 in the pathogenesis of colorectal carcinoma.
24165795 Data indicate that patients with combined immunodeficiency disease who share gain-of-function mutations in PIK3CD (p110delta), resulting in hyperactivation of mTOR signaling and skewed the differentiation of CD8+ T cells.
24136356 this study found E1021K in 17 patients with activated PI3K-delta syndrome (APDS), from seven unrelated families with, but not among 3346 healthy subjects.
24073214 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
23660190 These results suggest that PI3Kdelta mediates dsRNA-induced upregulation of B7-H1 without affecting the activation of NF-kappaB.
23486085 The expression of PIK3CD is inversely correlated with miR-30a levels in metastatic colorectal carcinoma tissues.
23341541 High PIK3CA/PIK3CD ratio identified a subset of primary mantle cell lymphomas resistant to GS-1101 and this ratio increased significantly with relapse.
23301033 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
23251686 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
23215766 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
23077641 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
22711705 Studies indicate that the research with phosphoinositide 3-kinase p110-delta (p110delta) in chronic lymphocytic leukemia (CLL) have led to a more fundamental understanding of CLL signaling defects.
22689948 PIK3CD shows evidence of association with schizophrenia, and is a previously undescribed therapeutic target for the treatment of psychiatric disorders.
22433439 PI3 kinase delta is a key regulator of synoviocyte function in rheumatoid arthritis.
22375552 present a detailed biochemical and bioinformatic characterization of p110delta gene regulation, demonstrating that PIK3CD has distinct promoters, some of which can be dynamically activated by pro-inflammatory mediators
22210877 Findings suggest that excessive PI3Kdelta activity is characteristic in Hodgkin lymphoma (HL) and support clinical evaluation of GS-1101, alone and in combination, as targeted therapy for HL.
22084313 p110delta-dependent translocation of exogenous CSF-1 to the nucleus-associated CSF-1Rs, correlating with a prominent role of p110delta in activation of the Rab5 GTPase, a key regulator of endocytic trafficking
22079609 Isoform specific targeting of PI3Kdelta may be beneficial in the treatment of glioblastoma multiforme by specifically inhibiting tumour cell migration capacity.
22020336 p37delta appears to be a new tumor-specific isoform of p110delta with growth-promoting properties
22015454 PI3K p110delta is important for TGFB1 induced production of the contractile proteins calponin and alpha-SMA and the proinflammatory cytokine IL-6
21810603 These observations suggest that PI3Kdelta contributes to induction of enhanced systemic lupus erythematosus memory T cell survival
21765914 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
21029719 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
20837746 IFN-beta triggers an atypical MEK2/PI3Kdelta signaling cascade to regulate sIL-1Ra expression in monocytes.
20818790 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
20702582 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20381852 PI3Kdelta expression and signaling is increased in the lungs of patients with COPD.
20197460 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20103642 Data show that similar responses were seen in cancer cells with wild-type or activated mutant PI3K genes treated with p110alpha/delta or p110alpha/beta/delta inhibitors in cell viability assays.
20081091 These studies establish that previously activated memory T cells are at least as sensitive to p110delta inhibition as naive T cells and show that mouse models accurately predict p110delta function in human T cells.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20041213 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
20019835 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
19913121 Observational study of gene-disease association. (HuGE Navigator)
19638627 RUNX1 may play a critical role in chemotherapy response in acute megakaryocytic leukemia by regulating the PI3-kinase/Akt pathway.
19357769 Results identify a conserved phosphoinositide 3-kinase p11delta promoter region that may account for the predominant leukocyte expression of p110delta.
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18854243 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
18471882 In contrast with PI3Kalpha, beta and gamma, PI3Kdelta accounts for most of the PI3K-dependent signaling ruling the production of IL-1beta, IL-6, TNF and sIL-1Ra in monocytes.
18453587 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
18348712 These results demonstrate that CD148 may interact with and dephosphorylate p85 when it is phosphorylated and modulate the magnitude of phosphoinositide 3-kinase activity.
18281552 novel function of the class I(A) PI3K isoform p110delta in neuroblastoma growth and survival.
17632570 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
17581634 identifies the RhoA/ROCK pathway as a major target of p110delta-mediated PI3K signalling
17290298 This review describes the second-messenger PI3K delta signalling pathways that are involved in immune responses relevant to the pathogenesis of rheumatoid arthritis and other inflammatory diseases.
17157319 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
17015696 p110delta contributes significantly to Th cell expansion and differentiation in vitro and in vivo, also in the context of CD28 costimulation.
16984281 These findings could shed light on further understanding the polymorphisms of p110delta in B-cell immunodeficiency and different populations.
16524887 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
16432180 p110beta, -gamma, and -delta isoforms of class I phosphoinositide 3-kinase have roles in oncogenic transformation
16081599 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
15878979 Stimulation of TNF-alpha-primed human neutrophils with fMLP results in biphasic activation of PI3K; the first phase is largely dependent on PI3Kgamma; the second phase is largely dependent on PI3Kdelta and regulates parallel activation of ROS production
15840695 p110delta isoform of PI3K is consistently expressed at a high level in blast cells from AML, in contrast to the other class I isoforms
15689238 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
14602571 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
12960231 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
12594293 PI3K delta can play a selective role in the amplification of phosphatidylinositol (3,4,5) trisphosphate (PIP3) levels that lead to neutrophil polarization and regulate directional migration, but not random locomotion.
12584329 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
12551992 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
12526811 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
12077252 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
11994280 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
11289809 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
11156964 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
11154208 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
10985305 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
10208934 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
9808187 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
9708406 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
9446795 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
9394803 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
9341793 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
9247029 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
8798481 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
8636073 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes

AA Sequence

MPPGVDCPMEFWTKEENQSVVVDFLLPTGVYLNFPVSRNANLSTIKQLLWHRAQYEPLFHMLSGPEAYVF      1 - 70
TCINQTAEQQELEDEQRRLCDVQPFLPVLRLVAREGDRVKKLINSQISLLIGKGLHEFDSLCDPEVNDFR     71 - 140
AKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSAQTWGPGTLRLPNRALLVNVKFEGSEESFTFQVSTK    141 - 210
DVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSS    211 - 280
SILAMRDEQSNPAPQVQKPRAKPPPIPAKKPSSVSLWSLEQPFRIELIQGSKVNADERMKLVVQAGLFHG    281 - 350
NEMLCKTVSSSEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW    351 - 420
ANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRSNPNTDSAAALLICLPEVAPHPVYYPALEK    421 - 490
ILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWNKHED    491 - 560
VAQMLYLLCSWPELPVLSALELLDFSFPDCHVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELT    561 - 630
KFLLDRALANRKIGHFLFWHLRSEMHVPSVALRFGLILEAYCRGSTHHMKVLMKQGEALSKLKALNDFVK    631 - 700
LSSQKTPKPQTKELMHLCMRQEAYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWIMYSNEEAGS    701 - 770
GGSVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLRSDTIANIQLN    771 - 840
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHI    841 - 910
DFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFAL    911 - 980
MRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESWKTKVNWLAHNVSKDNRQ          981 - 1044
//

Text Mined References (84)

PMID Year Title
26770665 2016 Increased expression of the PI3K catalytic subunit p110? underlies elevated S6 phosphorylation and protein synthesis in an individual with autism from a multiplex family.
26540567 2015 Bone marrow stroma-induced resistance of chronic lymphocytic leukemia cells to arsenic trioxide involves Mcl-1 upregulation and is overcome by inhibiting the PI3K? or PKC? signaling pathways.
26437962 2016 Activating PI3K? mutations in a cohort of 669 patients with primary immunodeficiency.
26286043 2015 Hyper-activated PI3K-? in immunodeficiency.
26265781 2015 Combined PI3K/Akt and Hsp90 targeting synergistically suppresses essential functions of alloreactive T cells and increases Tregs.
26251180 2015 Focal adhesion kinase phosphorylates the phosphatase and tensin homolog deleted on chromosome 10 under the control of p110? phosphoinositide-3 kinase.
25632006 2015 Expression of functional sphingosine-1 phosphate receptor-1 is reduced by B cell receptor signaling and increased by inhibition of PI3 kinase ? but not SYK or BTK in chronic lymphocytic leukemia cells.
25469863 2015 Discovery and in vivo evaluation of (S)-N-(1-(7-fluoro-2-(pyridin-2-yl)quinolin-3-yl)ethyl)-9H-purin-6-amine (AMG319) and related PI3K? inhibitors for inflammation and autoimmune disease.
25352054 2015 Gain of Function Mutations of PIK3CD as a Cause of Primary Sclerosing Cholangitis.
25327288 2014 Selective VPS34 inhibitor blocks autophagy and uncovers a role for NCOA4 in ferritin degradation and iron homeostasis in vivo.
24716596 2015 TNF?, PDGF, and TGF? synergistically induce synovial lining hyperplasia via inducible PI3K?.
24698326 2014 Occurrence of B-cell lymphomas in patients with activated phosphoinositide 3-kinase ? syndrome.
24648465 2014 Cross-species proteomics reveals specific modulation of signaling in cancer and stromal cells by phosphoinositide 3-kinase (PI3K) inhibitors.
24610295 2014 Mutations in PIK3CD can cause hyper IgM syndrome (HIGM) associated with increased cancer susceptibility.
24553178 2014 PI3K p110? uniquely promotes gain-of-function Shp2-induced GM-CSF hypersensitivity in a model of JMML.
24549598 2014 The association of leukocyte phosphatidylinositol 3-kinase delta overexpression with gestational diabetes mellitus (GDM).
24523440 2014 Primate-specific miR-663 functions as a tumor suppressor by targeting PIK3CD and predicts the prognosis of human glioblastoma.
24517182 2014 MiR-125b inhibits cell biological progression of Ewing's sarcoma by suppressing the PI3K/Akt signalling pathway.
24470496 2014 Phosphoinositide 3-kinase ? regulates migration and invasion of synoviocytes in rheumatoid arthritis.
24293274 2014 MicroRNA-30b functions as a tumour suppressor in human colorectal cancer by targeting KRAS, PIK3CD and BCL2.
24165795 2014 Dominant-activating germline mutations in the gene encoding the PI(3)K catalytic subunit p110? result in T cell senescence and human immunodeficiency.
24136356 2013 Phosphoinositide 3-kinase ? gene mutation predisposes to respiratory infection and airway damage.
23660190 2013 PI3K-delta mediates double-stranded RNA-induced upregulation of B7-H1 in BEAS-2B airway epithelial cells.
23486085 2013 miR-30a suppresses cell migration and invasion through downregulation of PIK3CD in colorectal carcinoma.
23341541 2013 P110?-mediated constitutive PI3K signaling limits the efficacy of p110?-selective inhibition in mantle cell lymphoma, particularly with multiple relapse.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22711705 2012 Molecular pathways: targeting phosphoinositide 3-kinase p110-delta in chronic lymphocytic leukemia.
22689948 2012 Neuregulin 1-ErbB4-PI3K signaling in schizophrenia and phosphoinositide 3-kinase-p110? inhibition as a potential therapeutic strategy.
22433439 2012 PI3 kinase ? is a key regulator of synoviocyte function in rheumatoid arthritis.
22375552 2012 Isoform-selective induction of human p110? PI3K expression by TNF?: identification of a new and inducible PIK3CD promoter.
22210877 2012 PI3K? inhibitor, GS-1101 (CAL-101), attenuates pathway signaling, induces apoptosis, and overcomes signals from the microenvironment in cellular models of Hodgkin lymphoma.
22084313 2012 Functional CSF-1 receptors are located at the nuclear envelope and activated via the p110? isoform of PI 3-kinase.
22079609 2012 The catalytic phosphoinositol 3-kinase isoform p110? is required for glioma cell migration and invasion.
22020336 2012 p37? is a new isoform of PI3K p110? that increases cell proliferation and is overexpressed in tumors.
22015454 2012 The phosphoinositide 3'-kinase p110? modulates contractile protein production and IL-6 release in human airway smooth muscle.
21810603 2011 Enhanced phosphoinositide 3-kinase ? activity is a frequent event in systemic lupus erythematosus that confers resistance to activation-induced T cell death.
20940048 2011 Phosphoinositide 3-kinase delta (PI3K?) in leukocyte signaling and function.
20837746 2010 A novel MEK2/PI3K? pathway controls the expression of IL-1 receptor antagonist in IFN-?-activated human monocytes.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20534549 2010 Activity of any class IA PI3K isoform can sustain cell proliferation and survival.
20381852 2010 A role for phosphoinositol 3-kinase delta in the impairment of glucocorticoid responsiveness in patients with chronic obstructive pulmonary disease.
20197460 2010 Pooled analysis of phosphatidylinositol 3-kinase pathway variants and risk of prostate cancer.
20189103 2010 Discovery of dual inhibitors of the immune cell PI3Ks p110delta and p110gamma: a prototype for new anti-inflammatory drugs.
20103642 2010 Isoform-specific phosphoinositide 3-kinase inhibitors exert distinct effects in solid tumors.
20081091 2010 PI3K p110delta regulates T-cell cytokine production during primary and secondary immune responses in mice and humans.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19843950 2009 Phosphoinositide 3-kinase p110 delta regulates natural antibody production, marginal zone and B-1 B cell function, and autoantibody responses.
19638627 2009 RUNX1 regulates phosphoinositide 3-kinase/AKT pathway: role in chemotherapy sensitivity in acute megakaryocytic leukemia.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19357769 2009 Regulation of p110delta PI 3-kinase gene expression.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18471882 2008 Differential regulation of cytokine production by PI3Kdelta in human monocytes upon acute and chronic inflammatory conditions.
18348712 2008 The tyrosine phosphatase CD148 interacts with the p85 regulatory subunit of phosphoinositide 3-kinase.
18281552 2008 Targeting the phosphoinositide 3-kinase isoform p110delta impairs growth and survival in neuroblastoma cells.
17581634 2007 The p110delta isoform of PI 3-kinase negatively controls RhoA and PTEN.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17290298 2007 PI3K delta and PI3K gamma: partners in crime in inflammation in rheumatoid arthritis and beyond?
17015696 2006 The p110delta isoform of phosphoinositide 3-kinase controls clonal expansion and differentiation of Th cells.
16984281 2006 Identification of variations in the human phosphoinositide 3-kinase p110delta gene in children with primary B-cell immunodeficiency of unknown aetiology.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16432180 2006 Oncogenic transformation induced by the p110beta, -gamma, and -delta isoforms of class I phosphoinositide 3-kinase.
15878979 2005 Sequential activation of class IB and class IA PI3K is important for the primed respiratory burst of human but not murine neutrophils.
15840695 2005 Essential role for the p110delta isoform in phosphoinositide 3-kinase activation and cell proliferation in acute myeloid leukemia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14602571 2003 Human immunodeficiency virus type 1 tat-mediated cytotoxicity of human brain microvascular endothelial cells.
12594293 2003 Essential role of phosphoinositide 3-kinase delta in neutrophil directional movement.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12077252 2002 Recruitment of phosphatidylinositol 3-kinase to CD28 inhibits HIV transcription by a Tat-dependent mechanism.
11994280 2002 HIV-1-Tat protein activates phosphatidylinositol 3-kinase/ AKT-dependent survival pathways in Kaposi's sarcoma cells.
11156964 2001 HIV-1 Tat protein down-regulates CREB transcription factor expression in PC12 neuronal cells through a phosphatidylinositol 3-kinase/AKT/cyclic nucleoside phosphodiesterase pathway.
11154208 2001 HIV-1 Tat promotes monocyte chemoattractant protein-1 secretion followed by transmigration of monocytes.
10949031 2000 Site-specific serine phosphorylation of the IL-3 receptor is required for hemopoietic cell survival.
10064595 1999 Autophosphorylation of p110delta phosphoinositide 3-kinase: a new paradigm for the regulation of lipid kinases in vitro and in vivo.
9708406 1998 HIV-1 Tat induces tyrosine phosphorylation of p125FAK and its association with phosphoinositide 3-kinase in PC12 cells.
9455486 1997 Identification and chromosome assignment of a human gene encoding a novel phosphatidylinositol-3 kinase.
9446795 1998 Extracellular HIV-1 Tat protein induces a rapid and selective activation of protein kinase C (PKC)-alpha, and -epsilon and -zeta isoforms in PC12 cells.
9394803 1997 Extracellular HIV-1 Tat protein activates phosphatidylinositol 3- and Akt/PKB kinases in CD4+ T lymphoblastoid Jurkat cells.
9235916 1997 p110delta, a novel phosphatidylinositol 3-kinase catalytic subunit that associates with p85 and is expressed predominantly in leukocytes.
9113989 1997 P110delta, a novel phosphoinositide 3-kinase in leukocytes.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8798481 1996 Extracellular human immunodeficiency virus type-1 Tat protein activates phosphatidylinositol 3-kinase in PC12 neuronal cells.