Property Summary

Ligand Count 450
NCBI Gene PubMed Count 139
PubMed Score 197.81
PubTator Score 110.70

Knowledge Summary

Patent (7,440)

Expression

  Differential Expression (20)

Disease log2 FC p
acute myeloid leukemia 2.300 2.7e-02
adult high grade glioma -1.400 2.0e-04
Astrocytoma, Pilocytic -1.100 3.0e-06
atypical teratoid / rhabdoid tumor -1.400 5.2e-04
dermatomyositis 1.100 4.0e-03
ependymoma -1.300 2.9e-09
glioblastoma -1.100 1.4e-05
group 4 medulloblastoma -1.700 5.6e-06
intraductal papillary-mucinous adenoma (... 2.100 3.7e-05
intraductal papillary-mucinous carcinoma... 1.900 9.8e-05
intraductal papillary-mucinous neoplasm ... 1.200 1.2e-02
medulloblastoma, large-cell -2.700 2.2e-06
osteosarcoma -2.523 4.7e-06
ovarian cancer -1.100 1.4e-03
pancreatic cancer 1.400 4.9e-05
pancreatic carcinoma 1.400 4.9e-05
primitive neuroectodermal tumor -1.800 6.1e-05
psoriasis -1.100 5.1e-04
tuberculosis and treatment for 3 months -1.100 7.7e-04
Waldenstrons macroglobulinemia 1.260 7.6e-03

Protein-protein Interaction (1)

Gene RIF (150)

AA Sequence

MCFSFIMPPAMADILDIWAVDSQIASDGSIPVDFLLPTGIYIQLEVPREATISYIKQMLWKQVHNYPMFN      1 - 70
LLMDIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGEKLDSKIGVLIGKGLHEFDSL     71 - 140
KDPEVNEFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVF    141 - 210
SFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPYDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRALPH    211 - 280
FILVECCKIKKMYEQEMIAIEAAINRNSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVK    281 - 350
VHVRAGLFHGTELLCKTIVSSEVSGKNDHIWNEPLEFDINICDLPRMARLCFAVYAVLDKVKTKKSTKTI    351 - 420
NPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRTGDIILHSWSSFPDELEEMLNPMGTVQTNPYTENATA    421 - 490
LHVKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLPVLKEILDRDPLSQLCENEMDLIWT    491 - 560
LRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPKLPPREALELLDFNYPDQYVREYAVGCLRQM    561 - 630
SDEELSQYLLQLVQVLKYEPFLDCALSRFLLERALGNRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCR    631 - 700
GSVGHMKVLSKQVEALNKLKTLNSLIKLNAVKLNRAKGKEAMHTCLKQSAYREALSDLQSPLNPCVILSE    701 - 770
LYVEKCKYMDSKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG    771 - 840
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEEFTLSCAGYCV    841 - 910
ASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFILTYDFIHVIQQGKTGNTEKFG    911 - 980
RFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKDIQYLKDSLALGKSEEEALKQFKQKFDEALR    981 - 1050
ESWTTKVNWMAHTVRKDYRS                                                     1051 - 1070
//

Text Mined References (143)

PMID Year Title