Property Summary

NCBI Gene PubMed Count 103
PubMed Score 204.81
PubTator Score 128.38

Knowledge Summary

Patent (9,028)

Expression

  Differential Expression (13)

Disease log2 FC p
lung cancer 1.100 9.6e-03
adult high grade glioma -1.400 1.0e-02
atypical teratoid / rhabdoid tumor -1.700 1.3e-05
Breast cancer -1.100 1.1e-05
colon cancer -2.600 1.2e-02
glioblastoma -1.200 6.6e-04
invasive ductal carcinoma -1.200 3.3e-03
lung adenocarcinoma -1.100 5.5e-13
medulloblastoma -1.100 2.1e-04
medulloblastoma, large-cell -2.200 1.2e-05
osteosarcoma 1.812 8.6e-07
ovarian cancer -1.900 1.3e-08
posterior fossa group A ependymoma 1.200 9.6e-06

Protein-protein Interaction (3)

Gene RIF (92)

AA Sequence

MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQVFAEGKPL      1 - 70
ALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVGGTTVSLFGKYGMFRQGM     71 - 140
HDLKVWPNVEADGSEPTKTPGRTSSTLSEDQMSRLAKLTKAHRQGHMVKVDWLDRLTFREIEMINESEKR    141 - 210
SSNFMYLMVEFRCVKCDDKEYGIVYYEKDGDESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSG    211 - 280
PSDHDLKPNAATRDQLNIIVSYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALE    281 - 350
LLGKWKPMDVEDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKK    351 - 420
DSQSSVSENVSNSGINSAEIDSSQIITSPLPSVSSPPPASKTKEVPDGENLEQDLCTFLISRACKNSTLA    421 - 490
NYLYWYVIVECEDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRSLLAAQQTFVDRLVHLMKAVQ    491 - 560
RESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVKIRGIIPETATLFKSALMPAQLFFKTEDGGK    561 - 630
YPVIFKHGDDLRQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSI    631 - 700
QNFFRKYAPSENGPNGISAEVMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDP    701 - 770
KPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVK    771 - 840
KVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK                           841 - 887
//

Text Mined References (107)

PMID Year Title