Property Summary

NCBI Gene PubMed Count 48
PubMed Score 3052.46
PubTator Score 1137.53

Knowledge Summary

Patent (24,803)

TINX Plot

  Disease (4)

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma 1.100 1.9e-02
ependymoma 1.900 5.7e-03
psoriasis 1.300 6.1e-04
osteosarcoma 3.551 2.1e-09
atypical teratoid / rhabdoid tumor 2.100 8.6e-04
glioblastoma 1.500 3.0e-02
medulloblastoma, large-cell 1.900 4.9e-07
primitive neuroectodermal tumor 1.100 1.8e-03
autosomal dominant Emery-Dreifuss muscul... 1.197 9.8e-03
juvenile dermatomyositis 1.020 2.4e-07
acute quadriplegic myopathy 1.400 6.0e-07
primary pancreatic ductal adenocarcinoma 1.127 2.4e-03
group 4 medulloblastoma 1.200 4.1e-02
progressive supranuclear palsy -1.500 7.7e-03
pancreatic cancer 1.100 8.5e-04

Gene RIF (58)

PMID Text
26387957 PI3KC2a knockdown results in rerouting of insulin signaling and pancreatic beta cell proliferation.
26175229 MiR-206 regulates endothelial progenitor cell activities by targeting PIK3C2alpha expression.The role of PIK3C2alpha in endothelial progenitor cell function in coronary artery disease
25779105 PI3KC2alpha has a role in regulating shear-dependent platelet adhesion via regulation of membrane structure, rather than acute signalling
25667265 a model of S. flexneri dissemination is proposed in which the formation of vacuole-like protrusions is mediated by the PIK3C2A-dependent production of the signaling lipid phosphatidylinositol 3-phosphate in the protrusion membrane
25614622 These observations indicate that PI3K-C2alpha plays the pivotal role in TGFbeta receptor endocytosis and thereby Smad2/3 signaling, participating in angiogenic actions of TGFbeta.
25233418 Data (including data from knockout mice) suggest that PI3KC2a participates in tumor angiogenesis. [REVIEW]
24073214 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
23320105 Class II enzyme PI3K-C2beta and the class IB isozyme p110gamma mainly regulate the S1P- and high density lipoprotein (HDL)-dependent endothelial cell (EC) migration and PI3K-C2alpha primarily controls EC survival
23301033 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
23251686 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
23215766 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
23192342 PI3K-C2alpha plays the crucial role in S1P(1) internalization into the intracellular vesicular compartment, Rac1 activation on endosomes, and thereby migration through regulating vesicular trafficking in ECs
21081650 These data suggest a general role for PI3KC2alpha in regulating physiologically relevant dynamin-independent internalization pathways.
21029719 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
20818790 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
20453000 Observational study of gene-disease association. (HuGE Navigator)
20416519 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20197460 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20019835 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
19591801 Taken together, these data suggest for the first time that in addition to class I PI3Ks in cancer, class II PIK3C2alpha can modulate hepatocellular carcinoma cell growth.
19261849 Observational study of gene-disease association. (HuGE Navigator)
18854243 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
18453587 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
18403640 Lowering the levels of PI3K-C2alpha in a number of cancer cell lines reduces their proliferation and cell viability.
17644513 phosphoinositide 3-kinase C2alpha has a role in insulin signaling
17632570 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
17157319 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
17110375 molecular linkage between PI3K-C2alpha and the microtubule motor machinery, with implications for membrane trafficking in intact cells
17038310 analysis of the PI specificities of PX domains and the mechanism by which the PI3K-C2alpha PX domain interacts with PtdIns(4,5)P(2)-containing membranes
16524887 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
16215232 demonstrated that the isolated clathrin binding domain of Phosphoinositide 3-kinase C2alpha can drive clathrin lattice assembly and can independently modulate clathrin distribution and function when expressed in cells
16081599 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
15689238 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
15183893 VEGFR1 and VEGFR2 initiate a clonogenic response in myeloid leukemia cells that is PI3-kinase dependent.
14729612 Nickel compounds induce HIF-1 transactivation and Cap43 protein expression through a PI-3K/Akt-dependent and p70(S6k)- independent pathway.
14602571 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
12960231 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
12584329 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
12551992 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
12526811 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
12237112 Phosphoinositide 3-kinase C2alpha was found to be differentially regulated by alpha(v)beta(3) and alpha(v)beta(5) integrin, and may represent a new regulatory pathway of cell migration downstream of integrin engagement.
12077252 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
11994280 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
11289809 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
11156964 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
11154208 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
10985305 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
10641798 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
10208934 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
9808187 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
9708406 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
9446795 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
9394803 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
9341793 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
9247029 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
8798481 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
8636073 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells

AA Sequence

MAQISSNSGFKECPSSHPEPTRAKDVDKEEALQMEAEALAKLQKDRQVTDNQRGFELSSSTRKKAQVYNK      1 - 70
QDYDLMVFPESDSQKRALDIDVEKLTQAELEKLLLDDSFETKKTPVLPVTPILSPSFSAQLYFRPTIQRG     71 - 140
QWPPGLPGPSTYALPSIYPSTYSKQAAFQNGFNPRMPTFPSTEPIYLSLPGQSPYFSYPLTPATPFHPQG    141 - 210
SLPIYRPVVSTDMAKLFDKIASTSEFLKNGKARTDLEITDSKVSNLQVSPKSEDISKFDWLDLDPLSKPK    211 - 280
VDNVEVLDHEEEKNVSSLLAKDPWDAVLLEERSTANCHLERKVNGKSLSVATVTRSQSLNIRTTQLAKAQ    281 - 350
GHISQKDPNGTSSLPTGSSLLQEVEVQNEEMAAFCRSITKLKTKFPYTNHRTNPGYLLSPVTAQRNICGE    351 - 420
NASVKVSIDIEGFQLPVTFTCDVSSTVEIIIMQALCWVHDDLNQVDVGSYVLKVCGQEEVLQNNHCLGSH    421 - 490
EHIQNCRKWDTEIRLQLLTFSAMCQNLARTAEDDETPVDLNKHLYQIEKPCKEAMTRHPVEELLDSYHNQ    491 - 560
VELALQIENQHRAVDQVIKAVRKICSALDGVETLAITESVKKLKRAVNLPRSKTADVTSLFGGEDTSRSS    561 - 630
TRGSLNPENPVQVSINQLTAAIYDLLRLHANSGRSPTDCAQSSKSVKEAWTTTEQLQFTIFAAHGISSNW    631 - 700
VSNYEKYYLICSLSHNGKDLFKPIQSKKVGTYKNFFYLIKWDELIIFPIQISQLPLESVLHLTLFGILNQ    701 - 770
SSGSSPDSNKQRKGPEALGKVSLPLFDFKRFLTCGTKLLYLWTSSHTNSVPGTVTKKGYVMERIVLQVDF    771 - 840
PSPAFDIIYTTPQVDRSIIQQHNLETLENDIKGKLLDILHKDSSLGLSKEDKAFLWEKRYYCFKHPNCLP    841 - 910
KILASAPNWKWVNLAKTYSLLHQWPALYPLIALELLDSKFADQEVRSLAVTWIEAISDDELTDLLPQFVQ    911 - 980
ALKYEIYLNSSLVQFLLSRALGNIQIAHNLYWLLKDALHDVQFSTRYEHVLGALLSVGGKRLREELLKQT    981 - 1050
KLVQLLGGVAEKVRQASGSARQVVLQRSMERVQSFFQKNKCRLPLKPSLVAKELNIKSCSFFSSNAVPLK   1051 - 1120
VTMVNADPMGEEINVMFKVGEDLRQDMLALQMIKIMDKIWLKEGLDLRMVIFKCLSTGRDRGMVELVPAS   1121 - 1190
DTLRKIQVEYGVTGSFKDKPLAEWLRKYNPSEEEYEKASENFIYSCAGCCVATYVLGICDRHNDNIMLRS   1191 - 1260
TGHMFHIDFGKFLGHAQMFGSFKRDRAPFVLTSDMAYVINGGEKPTIRFQLFVDLCCQAYNLIRKQTNLF   1261 - 1330
LNLLSLMIPSGLPELTSIQDLKYVRDALQPQTTDAEATIFFTRLIESSLGSIATKFNFFIHNLAQLRFSG   1331 - 1400
LPSNDEPILSFSPKTYSFRQDGRIKEVSVFTYHKKYNPDKHYIYVVRILREGQIEPSFVFRTFDEFQELH   1401 - 1470
NKLSIIFPLWKLPGFPNRMVLGRTHIKDVAAKRKIELNSYLQSLMNASTDVAECDLVCTFFHPLLRDEKA   1471 - 1540
EGIARSADAGSFSPTPGQIGGAVKLSISYRNGTLFIMVMHIKDLVTEDGADPNPYVKTYLLPDNHKTSKR   1541 - 1610
KTKISRKTRNPTFNEMLVYSGYSKETLRQRELQLSVLSAESLRENFFLGGVTLPLKDFNLSKETVKWYQL   1611 - 1680
TAATYL                                                                   1681 - 1686
//

Text Mined References (62)

PMID Year Title
26387957 2015 PI3K-C2? Knockdown Results in Rerouting of Insulin Signaling and Pancreatic Beta Cell Proliferation.
26175229 2015 Role of the microRNA, miR-206, and its target PIK3C2? in endothelial progenitor cell function – potential link with coronary artery disease.
25779105 2015 The class II PI 3-kinase, PI3KC2?, links platelet internal membrane structure to shear-dependent adhesive function.
25667265 2015 The class II phosphatidylinositol 3-phosphate kinase PIK3C2A promotes Shigella flexneri dissemination through formation of vacuole-like protrusions.
25614622 2015 Phosphatidylinositol 3-kinase class II ?-isoform PI3K-C2? is required for transforming growth factor ?-induced Smad signaling in endothelial cells.
25233418 2014 New insight into the intracellular roles of class II phosphoinositide 3-kinases.
24280982 2014 Polygenic dissection of diagnosis and clinical dimensions of bipolar disorder and schizophrenia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23320105 2013 Class II phosphoinositide 3-kinases contribute to endothelial cells morphogenesis.
23192342 2013 Essential role of class II phosphatidylinositol-3-kinase-C2? in sphingosine 1-phosphate receptor-1-mediated signaling and migration in endothelial cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21926974 2011 Genome-wide association study identifies five new schizophrenia loci.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21127054 2011 Class II phosphoinositide 3-kinase regulates exocytosis of insulin granules in pancreatic beta cells.
21081650 2010 PI3KC2?, a class II PI3K, is required for dynamin-independent internalization pathways.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20416519 2010 Absence of hotspot mutations in exons 9 and 20 of the PIK3CA gene in human oral squamous cell carcinoma in the Greek population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20197460 2010 Pooled analysis of phosphatidylinositol 3-kinase pathway variants and risk of prostate cancer.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19591801 2009 Ablation of phosphoinositide-3-kinase class II alpha suppresses hepatoma cell proliferation.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19261849 2009 Integrated genomic profiling of endometrial carcinoma associates aggressive tumors with indicators of PI3 kinase activation.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18403640 2008 Down-regulation of class II phosphoinositide 3-kinase alpha expression below a critical threshold induces apoptotic cell death.
17644513 2007 The role of phosphoinositide 3-kinase C2alpha in insulin signaling.
17371240 2007 Role of class II phosphoinositide 3-kinase in cell signalling.
17110375 2007 Phosphoinositide 3-kinase C2alpha links clathrin to microtubule-dependent movement.
17038310 2006 Structural and membrane binding analysis of the Phox homology domain of phosphoinositide 3-kinase-C2alpha.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16215232 2005 Individual phosphoinositide 3-kinase C2alpha domain activities independently regulate clathrin function.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15183893 2004 Vascular endothelial growth factor receptor-1 and receptor-2 initiate a phosphatidylinositide 3-kinase-dependent clonogenic response in acute myeloid leukemia cells.
14729612 2004 Nickel compounds act through phosphatidylinositol-3-kinase/Akt-dependent, p70(S6k)-independent pathway to induce hypoxia inducible factor transactivation and Cap43 expression in mouse epidermal Cl41 cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14602571 2003 Human immunodeficiency virus type 1 tat-mediated cytotoxicity of human brain microvascular endothelial cells.
14563213 2003 Topographical expression of class IA and class II phosphoinositide 3-kinase enzymes in normal human tissues is consistent with a role in differentiation.
12719431 2003 Mitotic and stress-induced phosphorylation of HsPI3K-C2alpha targets the protein for degradation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12237112 2002 Phosphoinositide 3-kinase C2alpha is activated upon smooth muscle cell migration and regulated by alpha(v)beta(3) integrin engagement.
12077252 2002 Recruitment of phosphatidylinositol 3-kinase to CD28 inhibits HIV transcription by a Tat-dependent mechanism.
11994280 2002 HIV-1-Tat protein activates phosphatidylinositol 3-kinase/ AKT-dependent survival pathways in Kaposi's sarcoma cells.
11606566 2001 Phosphatidylinositol 3-kinase c2alpha contains a nuclear localization sequence and associates with nuclear speckles.
11306805 2001 Mapping of genes and transcribed sequences in a gene rich 400-kb region on human chromosome 11p15.1-->p14.
11239472 2001 The class II phosphoinositide 3-kinase C2alpha is activated by clathrin and regulates clathrin-mediated membrane trafficking.
11156964 2001 HIV-1 Tat protein down-regulates CREB transcription factor expression in PC12 neuronal cells through a phosphatidylinositol 3-kinase/AKT/cyclic nucleoside phosphodiesterase pathway.
11154208 2001 HIV-1 Tat promotes monocyte chemoattractant protein-1 secretion followed by transmigration of monocytes.
10805725 2000 Class II phosphoinositide 3-kinases are downstream targets of activated polypeptide growth factor receptors.
10766823 2000 The class II phosphoinositide 3-kinase PI3K-C2alpha is concentrated in the trans-Golgi network and present in clathrin-coated vesicles.
10329640 1999 Insulin activates the alpha isoform of class II phosphoinositide 3-kinase.
9708406 1998 HIV-1 Tat induces tyrosine phosphorylation of p125FAK and its association with phosphoinositide 3-kinase in PC12 cells.
9603905 1998 A type II phosphoinositide 3-kinase is stimulated via activated integrin in platelets. A source of phosphatidylinositol 3-phosphate.
9446795 1998 Extracellular HIV-1 Tat protein induces a rapid and selective activation of protein kinase C (PKC)-alpha, and -epsilon and -zeta isoforms in PC12 cells.
9394803 1997 Extracellular HIV-1 Tat protein activates phosphatidylinositol 3- and Akt/PKB kinases in CD4+ T lymphoblastoid Jurkat cells.
9337861 1997 Cloning of a human phosphoinositide 3-kinase with a C2 domain that displays reduced sensitivity to the inhibitor wortmannin.
8798481 1996 Extracellular human immunodeficiency virus type-1 Tat protein activates phosphatidylinositol 3-kinase in PC12 neuronal cells.