Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
CILIARY DYSKINESIA, PRIMARY, 36, X-LINKED 1 0.0 0.0
Disease Target Count P-value
nasopharyngeal carcinoma 1058 4.0e-09
ependymoma 4679 1.1e-06
adult high grade glioma 3801 1.2e-04
Disease Target Count Z-score Confidence
Primary ciliary dyskinesia 76 5.38 2.7

Expression

  Differential Expression (3)

Disease log2 FC p
adult high grade glioma 1.100 1.2e-04
ependymoma 2.100 1.1e-06
nasopharyngeal carcinoma -1.700 4.0e-09

Gene RIF (1)

AA Sequence

MESENMDSENMKTENMESQNVDFESVSSVTALEALSKLLNPEEEDDSDYGQTNGLSTIGAMGPGNIGPPQ      1 - 70
IEELKVIPETSEENNEDIWNSEEIPEGAEYDDMWDVREIPEYEIIFRQQVGTEDIFLGLSKKDSSTGCCS     71 - 140
ELVAKIKLPNTNPSDIQIDIQETILDLRTPQKKLLITLPELVECTSAKAFYIPETETLEITMTMKRELDI    141 - 210
ANFF                                                                      211 - 214
//

Text Mined References (7)

PMID Year Title