Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.76
PubTator Score 7.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 2.9e-05
lung cancer 4473 4.3e-04
acute myeloid leukemia 785 4.2e-02

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.500 4.3e-04
acute myeloid leukemia -1.300 4.2e-02
ovarian cancer 1.400 2.9e-05

Gene RIF (7)

PMID Text
24656813 We propose that protein complexes assembled by the R2TP complex are defined by phosphorylation of a specific motif and recognition by the PIH1D1 subunit
24036451 PIH1D1 interacts with mTOR complex 1 and enhances ribosome RNA transcription.
23159623 this study investigated the interaction between RPAP3 and PIH1D1.
22368283 Human PIH1 domain-containing protein 1 (PIH1) interacts directly with histone H4 and recruits the Brg1-SWI/SNF complex via SNF5 to human rRNA genes.
21078300 These results suggest that PIH1D1 may also function as a novel modulator of apoptosis pathway.
20078948 PIH1D1 may stabilize SNF5 by attenuating its proteasome degradation pathway.
19450687 Is part of an RNA polymerase II-associated complex with possible chaperone activity.

AA Sequence

MANPKLLGMGLSEAEAIGADSARFEELLLQASKELQQAQTTRPESTQIQPQPGFCIKTNSSEGKVFINIC      1 - 70
HSPSIPPPADVTEEELLQMLEEDQAGFRIPMSLGEPHAELDAKGQGCTAYDVAVNSDFYRRMQNSDFLRE     71 - 140
LVITIAREGLEDKYNLQLNPEWRMMKNRPFMGSISQQNIRSEQRPRIQELGDLYTPAPGRAESGPEKPHL    141 - 210
NLWLEAPDLLLAEVDLPKLDGALGLSLEIGENRLVMGGPQQLYHLDAYIPLQINSHESKAAFHRKRKQLM    211 - 280
VAMPLLPVPS                                                                281 - 290
//

Text Mined References (22)

PMID Year Title
26711270 2015 A Novel Interaction of Ecdysoneless (ECD) Protein with R2TP Complex Component RUVBL1 Is Required for the Functional Role of ECD in Cell Cycle Progression.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
24656813 2014 Phosphorylation-dependent PIH1D1 interactions define substrate specificity of the R2TP cochaperone complex.
24036451 2013 PIH1D1 interacts with mTOR complex 1 and enhances ribosome RNA transcription.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23159623 2013 RPAP3 splicing variant isoform 1 interacts with PIH1D1 to compose R2TP complex for cell survival.
22368283 2012 Human PIH1 associates with histone H4 to mediate the glucose-dependent enhancement of pre-rRNA synthesis.
21492153 2011 Analysis of proteomic changes induced upon cellular differentiation of the human intestinal cell line Caco-2.
21269460 2011 Initial characterization of the human central proteome.
21078300 2010 PIH1D1, a subunit of R2TP complex, inhibits doxorubicin-induced apoptosis.
20864032 2010 CK2 phospho-dependent binding of R2TP complex to TEL2 is essential for mTOR and SMG1 stability.
20078948 2009 [Effect of PIH1D1 on the degradation of its binding protein SNF5].
19450687 2009 High-resolution mapping of the protein interaction network for the human transcription machinery and affinity purification of RNA polymerase II-associated complexes.
17636026 2007 A dynamic scaffold of pre-snoRNP factors facilitates human box C/D snoRNP assembly.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15670595 2005 Characterization of Saccharomyces cerevisiae Nop17p, a novel Nop58p-interacting protein that is involved in Pre-rRNA processing.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.