Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.38
PubTator Score 1.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
non-small cell lung cancer 1.428 8.6e-13
osteosarcoma -1.440 2.2e-04
ovarian cancer 1.100 3.9e-03
tuberculosis and treatment for 3 months -1.100 2.3e-04

Gene RIF (1)

AA Sequence

MAARVAAVRAAAWLLLGAATGLTRGPAAAFTAARSDAGIRAMCSEIILRQEVLKDGFHRDLLIKVKFGES      1 - 70
IEDLHTCRLLIKQDIPAGLYVDPYELASLRERNITEAVMVSENFDIEAPNYLSKESEVLIYARRDSQCID     71 - 140
CFQAFLPVHCRYHRPHSEDGEASIVVNNPDLLMFCDQEFPILKCWAHSEVAAPCALENEDICQWNKMKYK    141 - 210
SVYKNVILQVPVGLTVHTSLVCSVTLLITILCSTLILVAVFKYGHFSL                          211 - 258
//

Text Mined References (9)

PMID Year Title