Property Summary

NCBI Gene PubMed Count 11
PubMed Score 19.14
PubTator Score 4.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
acute myeloid leukemia -1.100 1.8e-02
astrocytic glioma -1.100 3.9e-03
intraductal papillary-mucinous adenoma (... 1.100 7.4e-03
osteosarcoma -2.821 6.5e-07
ovarian cancer -1.400 1.1e-06
subependymal giant cell astrocytoma 1.635 1.7e-02

Gene RIF (2)

AA Sequence

MRRPLSKCGMEPGGGDASLTLHGLQNRSHGKIKLRKRKSTLYFNTQEKSARRRGDLLGENIYLLLFTIAL      1 - 70
RILNCFLVQTSFVPDEYWQSLEVSHHMVFNYGYLTWEWTERLRSYTYPLIFASIYKILHLLGKDSVQLLI     71 - 140
WIPRLAQALLSAVADVRLYSLMKQLENQEVARWVFFCQLCSWFTWYCCTRTLTNTMETVLTIIALFYYPL    141 - 210
EGSKSMNSVKYSSLVALAFIIRPTAVILWTPLLFRHFCQEPRKLDLILHHFLPVGFVTLSLSLMIDRIFF    211 - 280
GQWTLVQFNFLKFNVLQNWGTFYGSHPWHWYFSQGFPVILGTHLPFFIHGCYLAPKRYRILLVTVLWTLL    281 - 350
VYSMLSHKEFRFIYPVLPFCMVFCGYSLTHLKTWKKPALSFLFLSNLFLALYTGLVHQRGTLDVMSHIQK    351 - 420
VCYNNPNKSSASIFIMMPCHSTPYYSHVHCPLPMRFLQCPPDLTGKSHYLDEADVFYLNPLNWLHREFHD    421 - 490
DASLPTHLITFSILEEEISAFLISSNYKRTAVFFHTHLPEGRIGSHIYVYERKLKGKFNMKMKF          491 - 554
//

Text Mined References (12)

PMID Year Title