Property Summary

NCBI Gene PubMed Count 4
PubMed Score 24.61
PubTator Score 74.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

AA Sequence

MCFSRADAADNYPFGTCQQRKLFPHFHPPNLIGNKFVPLRGSPHRGPGCYFSDGYGLAYDLSKIPTSIKG      1 - 70
YTLGARTAVRFKPIQKEMTPHAGRYQKVSPQQEKHKQNFAPFNVLVPRFKNYPKDTYYPSPGAYNPEKKP     71 - 140
PPKIAWPMKFGSPDWAQVPCLQKRTLKAELSTDKDFRKHRNRVAYLSLYYN                       141 - 191
//

Text Mined References (7)

PMID Year Title