Property Summary

NCBI Gene PubMed Count 28
PubMed Score 92.01
PubTator Score 31.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.759 1.3e-05
primary pancreatic ductal adenocarcinoma -1.087 3.3e-02
group 3 medulloblastoma 1.300 9.2e-03
pancreatic cancer -1.200 4.5e-02

 GO Function (1)

 MGI Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (15)

PMID Text
25936804 By sequestering PIDD at the kinetochore, BubR1 acts to delay PIDDosome formation until the next cycle, defining a new mechanism by which cells evade apoptosis during mitosis.
22854598 The ATM phosphorylation of the PIDD DD enables a binary switch through which cells elect to survive or die upon DNA injury.
21415862 PIDD performs key functions upon UV irradiation, including TLS, NHEJ, NF-kappaB activation and cell death.
21371439 a new splicing variant of PIDD named PIDD4 is reported.
20966961 Hsp90 has a major role in controlling PIDD functional activity.
20406701 point mutations on RAIDD (R147E) and on PIDD (Y814A) exert a dominant negative effect on the formation of the PIDDosome, and that this effect cannot be applied after the PIDDosome has been formed
20208132 Total caspase-2 is upregulated during tumour progression in renal cell carcinomas.
18238895 p53-mediated apoptosis occurs by a PIDD- and caspase 2-dependent mechanism, and p53's full transcriptional regulatory functions may be required only for events that are downstream of cytochrome c release
17637755 PIDD isoforms are capable of activating nuclear factor-kappaB in response to genotoxic stress, but only isoform 1 interacts with RIP-associated ICH-1/CED-3 homologous protein with a death domain and activates caspase-2.
17437012 No correlation between Pidd expression and the p53 mutation status of oral squamous cell carcinoma, suggesting that Pidd expression may be regulated by p53-independent mechanisms.
17329820 PIDD death domain (DD) and RAIDD DD assemble into an oligomeric complex. Within the PIDDosome, the interaction between PIDD and RAIDD is mediated by a homotypic interaction between their death domains.
17159900 PIDD autoproteolysis marks the bifurcation between pro-death caspase-2 and pro-survival NF-kappaB pathway
16982033 The functional consequences of the identified PIDD/nucleolin interaction remain to be elucidated, but may be related to a recently discovered new role for PIDD in the activation of NF-kappaB upon genotoxic stress.
16360037 PIDD plays a critical role in DNA-damage-induced NF-kappaB activation, controlling the balance between life and death upon DNA damage.
15073321 activation of caspase-2 occurs in a complex that contains PIDD, whose expression is induced by p53, and RAIDD; increased PIDD expression resulted in spontaneous activation of caspase-2 and sensitization to apoptosis by genotoxic stimuli

AA Sequence

MAATVEGPELEAAAAAGDASEDSDAGSRALPFLGGNRLSLDLYPGGCQQLLHLCVQQPLQLLQVEFLRLS      1 - 70
THEDPQLLEATLAQLPQSLSCLRSLVLKGGQRRDTLGACLRGALTNLPAGLSGLAHLAHLDLSFNSLETL     71 - 140
PACVLQMRGLGALLLSHNCLSELPEALGALPALTFLTVTHNRLQTLPPALGALSTLQRLDLSQNLLDTLP    141 - 210
PEIGGLGSLLELNLASNRLQSLPASLAGLRSLRLLVLHSNLLASVPADLARLPLLTRLDLRDNQLRDLPP    211 - 280
ELLDAPFVRLQGNPLGEASPDAPSSPVAALIPEMPRLFLTSDLDSFPVTPQGCSVTLACGVRLQFPAGAT    281 - 350
ATPITIRYRLLLPEPGLVPLGPHDALLSHVLELQPHGVAFQQDVGLWLLFTPPQARRCREVVVRTRNDNS    351 - 420
WGDLETYLEEEAPQRLWAHCQVPHFSWFLVVSRPVSNACLVPPEGTLLCSSGHPGVKVIFPPGATEEPRR    421 - 490
VSMQVVRMAGRELQALLGEPEAAVSPLLCLSQSGPPSFLQPVTVQLPLPSGITGLSLDRSRLHLLYWAPP    491 - 560
AATWDDITAQVVLELTHLYARFQVTHFSWYWLWYTTKNCVGGLARKAWERLRLHRVNLIALQRRRDPEQV    561 - 630
LLQCLPRNKVDATLRRLLERYRGPEPSDTVEMFEGEEFFAAFERGIDVDADRPDCVEGRICFVFYSHLKN    631 - 700
VKEVYVTTTLDREAQAVRGQVSFYRGAVPVRVPEEAEAARQRKGADALWMATLPIKLPRLRGSEGPRRGA    701 - 770
GLSLAPLNLGDAETGFLTQSNLLSVAGRLGLDWPAVALHLGVSYREVQRIRHEFRDDLDEQIRHMLFSWA    771 - 840
ERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLELGRRKYQDSIRRMGLAPKDPALPGSSAPQPPEPAQA    841 - 910
//

Text Mined References (29)

PMID Year Title
25936804 2015 An Inhibitor of PIDDosome Formation.
22854598 2012 PIDD death-domain phosphorylation by ATM controls prodeath versus prosurvival PIDDosome signaling.
21726810 2011 Caspase-2-mediated cleavage of Mdm2 creates a p53-induced positive feedback loop.
21415862 2011 PIDD orchestrates translesion DNA synthesis in response to UV irradiation.
21371439 2011 PIDD4, a novel PIDD isoform without the LRR domain, can independently induce cell apoptosis in cytoplasm.
20966961 2011 Regulation of PIDD auto-proteolysis and activity by the molecular chaperone Hsp90.
20935634 2010 The Fas-FADD death domain complex structure reveals the basis of DISC assembly and disease mutations.
20406701 2010 Identification and analysis of dominant negative mutants of RAIDD and PIDD.
20395368 2010 Chronic cisplatin treatment promotes enhanced damage repair and tumor progression in a mouse model of lung cancer.
20208132 2010 PIDDosome expression and the role of caspase-2 activation for chemotherapy-induced apoptosis in RCCs.
19060904 2009 An empirical framework for binary interactome mapping.
18309324 2008 No death without life: vital functions of apoptotic effectors.
18238895 2008 A role for caspase 2 and PIDD in the process of p53-mediated apoptosis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17637755 2008 p53-induced protein with a death domain (PIDD) isoforms differentially activate nuclear factor-kappaB and caspase-2 in response to genotoxic stress.
17437012 2007 The expression of p53-induced protein with death domain (Pidd) and apoptosis in oral squamous cell carcinoma.
17329820 2007 Crystallization and preliminary X-ray crystallographic studies of the oligomeric death-domain complex between PIDD and RAIDD.
17159900 2007 Autoproteolysis of PIDD marks the bifurcation between pro-death caspase-2 and pro-survival NF-kappaB pathway.
16982033 2006 Upon intracellular processing, the C-terminal death domain-containing fragment of the p53-inducible PIDD/LRDD protein translocates to the nucleoli and interacts with nucleolin.
16652156 2006 Functional connection between p53 and caspase-2 is essential for apoptosis induced by DNA damage.
16360037 2005 PIDD mediates NF-kappaB activation in response to DNA damage.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15073321 2004 The PIDDosome, a protein complex implicated in activation of caspase-2 in response to genotoxic stress.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10973264 2000 Pidd, a new death-domain-containing protein, is induced by p53 and promotes apoptosis.
10825539 2000 LRDD, a novel leucine rich repeat and death domain containing protein.