Property Summary

NCBI Gene PubMed Count 21
PubMed Score 64.11
PubTator Score 26.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma -2.224 2.4e-03
Astrocytoma, Pilocytic 1.300 8.4e-04
Atopic dermatitis -1.100 2.9e-03
atypical teratoid / rhabdoid tumor -2.200 6.3e-03
breast carcinoma -1.600 1.0e-05
cystic fibrosis 4.874 3.3e-07
ductal carcinoma in situ -2.300 6.9e-05
fibroadenoma -1.700 3.0e-04
glioblastoma -1.600 8.0e-03
group 3 medulloblastoma -1.900 2.7e-02
invasive ductal carcinoma -1.204 5.6e-03
lung adenocarcinoma -1.300 6.3e-17
lung cancer -2.300 1.6e-04
malignant mesothelioma -3.700 1.7e-09
medulloblastoma, large-cell -2.200 4.8e-02
non-inflammatory breast cancer -1.100 5.4e-03
non-small cell lung cancer -2.197 1.2e-21
oligodendroglioma 1.400 3.6e-02
ovarian cancer -2.500 8.6e-09
pancreatic ductal adenocarcinoma liver m... -1.147 5.6e-04
psoriasis -1.600 1.1e-06
tuberculosis and treatment for 6 months -1.200 4.6e-02

Synonym

Accession Q7Z2X4 B3KU82 Q68CJ2 Q6ZUS3 Q8IXL0 Q9NWP6 P-CLI1
Symbols PCLI1
NYGGF4
P-CLI1
HMFN2073

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

 GO Component (1)

Gene RIF (11)

AA Sequence

MFSLPLSLPLCEDTAFLPSKCCSSHKTIKQARTLIMIFLASGTHFQTMLKSKLNVLTLKKEPLPAVIFHE      1 - 70
PEAIELCTTTPLMKTRTHSGCKVTYLGKVSTTGMQFLSGCTEKPVIELWKKHTLAREDVFPANALLEIRP     71 - 140
FQVWLHHLDHKGEATVHMDTFQVARIAYCTADHNVSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKK    141 - 210
LAHAMMEAFRKTFHSMKSDGRIHSNSSSEEVSQELESDDG                                  211 - 250
//

Text Mined References (21)

PMID Year Title