Property Summary

NCBI Gene PubMed Count 61
PubMed Score 148.63
PubTator Score 2023.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 5.2e-08
glioblastoma -1.600 1.1e-06
medulloblastoma, large-cell -1.500 1.8e-06
pediatric high grade glioma -1.300 2.7e-06

Gene RIF (30)

PMID Text
26466675 We propose that PICK1 negatively regulates neoplastic infiltration of astrocytic tumors and that manipulation of PICK1 is an attractive possibility for therapeutic intervention
26073603 Unlike accessory domains in other BAR domain proteins, the positioning of the PDZ domains is flexible, enabling PICK1 to perform long-range, dynamic scaffolding of membrane-associated proteins.
25657323 PICK1 domain ACT links PICK1-associated vesicles to a motility factor, likely myosin, but, contrary to previous reports, PICK1 neither binds nor inhibits Arp2/3 complex.
25023278 Data indicate three principal binding modes can account for protein interacting with C-kinase 1 (PICK1) PDZ domains binding specificity.
24937449 These data indicate that Pick1 is involved in regulating the cell-cell junction in epithelial cells.
24723684 PICK1 promotes Ago2 localization at endosomal compartments in neuronal dendrites and inhibits Ago2 function in translational repression following neuronal stimulation.
24358315 C-terminal domain of ICA69 interacts with PICK1 and acts on trafficking of PICK1-PKCalpha complex and cerebellar plasticity.
22710801 PICK1 increases caveolin-mediated endocytosis, ubiquitination and degradation of TGF-beta type I receptor.
22436349 Family-based association study failed to observe a statistically significant association for any of the genotyped SNPs in the PICK1 gene and attention-deficit hyperactivity disorder.
22303009 Our data suggest a selective role of PICK1 in clustering and reducing the recycling rates of PDZ domain binding partners sorted to the Rab11-dependent recycling pathway.
22275068 The binding affinities of all major PICK1 interacting proteins are reported and the effects of PICK1 mutations on these interactions are described.
21949352 PICK1 is a suppressor of spinocerebellar ataxia 3-associated neurodegeneration.
21690291 Neph proteins and PICK1 synergistically regulate cell recognition and contact formation; Binding required dimerization of PICK1, was dependent on PDZ domain protein interactions, and mediated stabilization of Neph1 at the plasma membrane.
20562896 we have identified a homozygous mutation in the PICK1 gene that is associated with globozoospermia in humans
20385472 The PICK1 mRNA is elevated in patient with schizophrenia.
20384629 Protein interacting with C alpha kinase 1 (PICK1) is involved in promoting tumor growth and correlates with poor prognosis of human breast cancer.
20018661 Results describe the first small-molecule inhibitor (FSC231) of the PDZ domain in PICK1, which binds the PICK1 PDZ domain with an affinity similar to that observed for endogenous peptide ligands.
19219857 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18692513 KRIP6 regulates kainate receptors by inhibiting PICK1 modulation via competition or a mutual blocking effect
17914463 PICK1 synaptic targeting requires direct interaction between the PDZ domain and lipid membranes
17606663 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17606663 findings suggest that the PICK1 gene may be implicated in the susceptibility to spontaneous relapse of methamphetamine psychosis and that, as an intracellular adapter protein, PICK1 may play a role in the pathophysiology of methamphetamine psycho
17367885 Observational study of gene-disease association. (HuGE Navigator)
17367885 polymorphisms of the PICK1 gene identified thus far are unlikely to contribute to genetic susceptibility to schizophrenia in the Japanese population
16314870 In a case-control association study, an association of the PICK1 gene with schizophrenia (SZ) was seen, which is more prominent in disorganized SZ. Findings implicating PICK1 are consistent with a role for D-serine in the disease.
15811349 PICK-1 could be involved in the regulation of both adherens and tight junctions in epithelial cells
15305146 Observational study of gene-disease association. (HuGE Navigator)
15305146 The PICK1 rs3952 polymorphism was genotyped in schizophrenia and controls. Results demonstrated that the PICK1 rs3952 genotype and allele distribution was significantly different between the two groups.
11891216 binding with glutamate receptor subtype

AA Sequence

MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEI      1 - 70
TGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLS     71 - 140
RAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQPAASEAFVKF    141 - 210
ADAHRSIEKFGIRLLKTIKPMLTDLNTYLNKAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIAL    211 - 280
GEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYA    281 - 350
VLRDADVFPIEVDLAHTTLAYGLNQEEFTDGEEEEEEEDTAAGEPSRDTRGAAGPLDKGGSWCDS         351 - 415
//

Text Mined References (64)

PMID Year Title
26466675 2015 Protein interacting with C kinase 1 suppresses invasion and anchorage-independent growth of astrocytic tumor cells.
26073603 2015 Structure of Dimeric and Tetrameric Complexes of the BAR Domain Protein PICK1 Determined by Small-Angle X-Ray Scattering.
25657323 2015 PICK1 is implicated in organelle motility in an Arp2/3 complex-independent manner.
25023278 2014 Protein interacting with C-kinase 1 (PICK1) binding promiscuity relies on unconventional PSD-95/discs-large/ZO-1 homology (PDZ) binding modes for nonclass II PDZ ligands.
24937449 2014 Pick1 modulates ephrinB1-induced junctional disassembly through an association with ephrinB1.
24723684 2014 PICK1 links Argonaute 2 to endosomes in neuronal dendrites and regulates miRNA activity.
24358315 2013 C-terminal domain of ICA69 interacts with PICK1 and acts on trafficking of PICK1-PKC? complex and cerebellar plasticity.
22710801 2012 PICK1 promotes caveolin-dependent degradation of TGF-? type I receptor.
22436349 2012 Family-based association study of cocaine- and amphetamine-regulated transcript (CARTPT) and protein interaction with C-kinase-1 (PICK1) genes in attention-deficit hyperactivity disorder.
22303009 2012 Protein interacting with C kinase 1 (PICK1) reduces reinsertion rates of interaction partners sorted to Rab11-dependent slow recycling pathway.
22275068 2012 The binding affinities of proteins interacting with the PDZ domain of PICK1.
21949352 2012 Protein interacting with C kinase (PICK1) is a suppressor of spinocerebellar ataxia 3-associated neurodegeneration in Drosophila.
21690291 2011 The BAR domain protein PICK1 regulates cell recognition and morphogenesis by interacting with Neph proteins.
20562896 2010 A newly discovered mutation in PICK1 in a human with globozoospermia.
20403402 2010 Threonine 82 at the PDZ domain of PICK1 is critical for AMPA receptor interaction and localization.
20385472 2010 Elevated PICK1 mRNA in schizophrenia increased SRR mRNA in suicide.
20384629 2010 Protein interacting with C alpha kinase 1 (PICK1) is involved in promoting tumor growth and correlates with poor prognosis of human breast cancer.
20018661 2010 Identification of a small-molecule inhibitor of the PICK1 PDZ domain that inhibits hippocampal LTP and LTD.
19219857 2009 Genetic association studies of methamphetamine use disorders: A systematic review and synthesis.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18692513 2008 The BTB/kelch protein, KRIP6, modulates the interaction of PICK1 with GluR6 kainate receptors.
17914463 2007 Clustering and synaptic targeting of PICK1 requires direct interaction between the PDZ domain and lipid membranes.
17606663 2007 Identification of functional polymorphisms in the promoter region of the human PICK1 gene and their association with methamphetamine psychosis.
17384233 2007 Structure of PICK1 and other PDZ domains obtained with the help of self-binding C-terminal extensions.
17367885 2007 PICK1 is not a susceptibility gene for schizophrenia in a Japanese population: association study in a large case-control population.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16314870 2006 Serine racemase binds to PICK1: potential relevance to schizophrenia.
16055064 2005 PICK1 interacts with ABP/GRIP to regulate AMPA receptor trafficking.
15811349 2005 PICK-1: a scaffold protein that interacts with Nectins and JAMs at cell junctions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15458844 2004 The complexity of PDZ domain-mediated interactions at glutamatergic synapses: a case study on neuroligin.
15305146 2004 Association study of PICK1 rs3952 polymorphism and schizophrenia.
15304526 2004 A role for the PDZ-binding domain of the coxsackie B virus and adenovirus receptor (CAR) in cell adhesion and growth.
15247289 2004 The PDZ domain of PICK1 differentially accepts protein kinase C-alpha and GluR2 as interacting ligands.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14550765 2003 Specific involvement in neuropathic pain of AMPA receptors and adapter proteins for the GluR2 subunit.
12941441 2003 Functional roles of protein interactions with AMPA and kainate receptors.
12826667 2003 PICK1, an anchoring protein that specifically targets protein kinase Calpha to mitochondria selectively upon serum stimulation in NIH 3T3 cells.
12597860 2003 Rapid and differential regulation of AMPA and kainate receptors at hippocampal mossy fibre synapses by PICK1 and GRIP.
12578970 2003 cAMP-dependent protein kinase phosphorylation of the acid-sensing ion channel-1 regulates its binding to the protein interacting with C-kinase-1.
12529303 2003 Reevaluating human gene annotation: a second-generation analysis of chromosome 22.
12508107 2003 Functional interaction of megalin with the megalinbinding protein (MegBP), a novel tetratrico peptide repeat-containing adaptor molecule.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12399460 2002 Protein kinase C stimulates the acid-sensing ion channel ASIC2a via the PDZ domain-containing protein PICK1.
12138111 2002 A novel Dnmt3a isoform produced from an alternative promoter localizes to euchromatin and its expression correlates with active de novo methylation.
12065412 2002 PICK1 is required for the control of synaptic transmission by the metabotropic glutamate receptor 7.
11891216 2002 The PDZ proteins PICK1, GRIP, and syntenin bind multiple glutamate receptor subtypes. Analysis of PDZ binding motifs.
11802773 2002 Interaction of the synaptic protein PICK1 (protein interacting with C kinase 1) with the non-voltage gated sodium channels BNC1 (brain Na+ channel 1) and ASIC (acid-sensing ion channel).
11739374 2002 The PDZ domain protein PICK1 and the sodium channel BNaC1 interact and localize at mechanosensory terminals of dorsal root ganglion neurons and dendrites of central neurons.
11641419 2001 The carboxyl terminus of the prolactin-releasing peptide receptor interacts with PDZ domain proteins involved in alpha-amino-3-hydroxy-5-methylisoxazole-4-propionic acid receptor clustering.
11343649 2001 Functional interaction between monoamine plasma membrane transporters and the synaptic PDZ domain-containing protein PICK1.
11278603 2001 The ERBB2/HER2 receptor differentially interacts with ERBIN and PICK1 PSD-95/DLG/ZO-1 domain proteins.
11237868 2001 Mitogen-stimulated TIS21 protein interacts with a protein-kinase-Calpha-binding protein rPICK1.
11007882 2000 PICK1 interacts with and regulates PKC phosphorylation of mGLUR7.
10839360 2000 EphB2 guides axons at the midline and is necessary for normal vestibular function.
10623590 2000 Interaction of the PDZ domain of human PICK1 with class I ADP-ribosylation factors.
10591208 1999 The DNA sequence of human chromosome 22.
10340301 1999 The protein kinase C alpha binding protein PICK1 interacts with short but not long form alternative splice variants of AMPA receptor subunits.
9883737 1998 PDZ proteins bind, cluster, and synaptically colocalize with Eph receptors and their ephrin ligands.
9405395 1997 Specific interaction of the PDZ domain protein PICK1 with the COOH terminus of protein kinase C-alpha.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7844141 1995 PICK1: a perinuclear binding protein and substrate for protein kinase C isolated by the yeast two-hybrid system.