Property Summary

NCBI Gene PubMed Count 89
PubMed Score 81.15
PubTator Score 96.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Multiple myeloma 1.130 1.2e-04
psoriasis 1.100 3.2e-03
osteosarcoma 2.826 2.0e-06
ependymoma 1.300 2.0e-03
astrocytoma 1.200 3.9e-02
glioblastoma 1.100 2.9e-02
atypical teratoid / rhabdoid tumor 1.500 2.9e-03
medulloblastoma -1.100 2.5e-03
medulloblastoma, large-cell -2.100 9.1e-05
juvenile dermatomyositis 1.082 1.5e-10
lung cancer -1.400 2.2e-02
pilocytic astrocytoma 1.100 3.9e-02
lung adenocarcinoma 1.549 8.3e-07
progressive supranuclear palsy -1.100 9.2e-03
Breast cancer -1.100 2.8e-11
ovarian cancer 1.600 3.5e-04
Gaucher disease type 1 -1.600 2.5e-02
Down syndrome 2.000 6.1e-04
dermatomyositis 2.000 1.4e-04

Protein-protein Interaction (12)

Gene RIF (73)

PMID Text
26434199 the rs541458 and rs3851179 of PICALM SNPs are not related to development of behavioral and psychological symptoms of dementia in Turkish population
25898166 CALM is a major factor in controlling endocytic clathrin-coated vesicle size and maturation and hence in determining the rates of endocytic cargo uptake.
25359311 We detected a significant association of the MTHFR rs1801133 and PICALM rs3851179 polymorphisms with AD.
25241929 PICALM has a role in modulating autophagy activity and tau accumulation
25169757 allelic expression has shown that compelling PICALM allelic expression imbalance was not observed in most brain RNA samples
25022885 PICALM SNP is significantly associated with late onset Alzheimer disease.
24660791 physical activity attenuated the effects of genetic risk (ie. the constellation of PICALM, BIN1, and CLU polymorphisms) on episodic memory
24618820 multiple PICALM isoforms are expressed in the human brain, that PICALM is robustly expressed in microvessels, and that expression of total PICALM is modestly correlated with the AD-associated SNP rs3851179.
24613704 Data suggest a neural mechanism for APOE-PICALM interactions in patients with manifest Alzheimer's disease and indicate that the PICALM genotype modulates both brain atrophy and cognitive performance in APOE epsilon4 carrier
24578178 PICALM and CLU risk genotypes exert differential impacts on the hippocampal resting-state functional connectivity in healthy young subjects.
24095218 It might not play a major role in the genetic predisposition to Late-onset Alzheimer's disease in Han Chinese.
24076290 We identified a mutation in CALM1 underlying IVF manifesting in childhood and adolescence. The causality of the mutation is supported by previous studies demonstrating that F90 mediates the direct interaction of CaM with target peptides.
24067654 AP-2/PICALM complex functions as an autophagic cargo receptor for the recognition and shipment of APP-CTF from the endocytic pathway to the LC3-marked autophagic degradation pathway.
23870418 This results suggest that besides APOE, PICALM associated with Alzheimer's disease risk do not exert large effects on the age-at-onset phenotype of Alzheimer disease.
23741335 CALM is able to sort VAMP4 and VAMP7, even though they have sorting signals for other clathrin adaptors.
23670296 detection of PICALM-MLLT10 fusion transcript occurs in 7% of children with T-lineage ALL and is not associated with a poorer outcome for patients treated with contemporary, intensive chemotherapy
23650005 Genome-wide association studies found 3 new susceptibility loci for Alzheimer disease(AD): complement receptor 1,clusterin,and the phosphatidylinositol-binding clathrin assembly protein. These SNPS are not associated with AD in a Polish population.
23601808 PICALM affects age at onset of Alzheimer's dementia in Down syndrome.
23572399 The PICALM rs3851179 polymorphism is significantly associated with AD in the Asian population by both pooled analysis and meta-analysis methods.
23487024 A CALM-derived nuclear export signal is essential for CALM-AF10-mediated leukemogenesis.
23040034 Our results indicate that rs3851179 may not be an AD susceptibility locus in the Chinese population and the APOEepsilon4-negative subgroup.
22975751 results confirm the association of PICALM gene with Alzheimer disease susceptibility in Korean population
22952074 CLU and CR1 were associated with more rapid cognitive decline. PICALM was associated with an earlier age at midpoint of cognitive decline.
22943764 rs592297, a known coding synonymous SNP that is part of an exonic splice enhancer region in exon 5 of the PICALM gene, is in strong linkage disequilibrium with rs3851179.
22888099 model system to study the effects of intracellular Abeta in fusion with green fluorescent protein. We sent this fusion protein into the secretory pathway and showed that intracellular traffic pathways are necessary for the generation of toxic species.
22715855 Our results do not provide evidence that the PICALM rs3851179 polymorphism increase susceptibility to Parkinson disease, in the Greek population.
22639918 AP180 and CALM are endocytic adaptors dedicated to the sorting of small soluble N-ethylmaleimide-sensitive-factor attachment protein receptors. (Review)
22539578 The SNP genotype pattern at the PICALM gene is associated with episodic memory.
22539346 PICALM, an adaptor protein involved in clathrin-mediated endocytosis, regulates APP internalization and subsequent Abeta generation. PICALM contributes to amyloid plaque load in brain likely via its effect on Abeta metabolism.
22402018 In conclusion, we confirmed association of CLU, CR1, and PICALM genes with the disease status in our cohort through identification of a number of disease-specific variants
22064352 results strongly indicate that the differential regulation of these three genes is not due to the break point effect but as a consequence of the CALM/AF10 fusion gene expression, though the mechanism of regulation is not well understood
22015308 findings showed evidence of CR1, CLU, and PICALM and late-onset Alzheimer's disease (LOAD) susceptibility in an independent southern Chinese population
21965661 AP-2 and epsin-1 are both required to promote efficient internalization of activated PAR1 and recognize discrete receptor sorting signals
21912625 relationship of Parkinson's disease with SNPs of CLU, CR1 and PICALM
21706055 In leukemia cells, full-length CALM-AF10 localized to the nucleus with no consistent effect on growth factor endocyctosis, and suppressed histone H3 lysine 79 methylation regardless of the presence of clathrin
21358043 Single nucleotide polymorphisms (SNPs) are not significantly different within PICALM sporadic Alzheimer disease patients and unrelated age- and sex-matched healthy controls of Han Chinese.
21347408 variants in BIN1, CLU, CR1 or PICALM are associated with changes in the CSF levels of biomarkers
21300948 This study provides compelling independent evidence that genetic variants in CLU, CR1, and PICALM are genetically associated with risk for AD.
21297266 This study suggested that the PICALM rs3851179 showed no statistically significant difference between LOAD cases and controls.
21221849 Data show that CALM influences the cell surface level of the AMPA receptor subunit GluR2.
21220176 we confirmed that PICALM is a genetic determinants of Alzheimer disease.
21059989 picalm polymorphisms were associated with late-onset Alzheimer disease in an independent cohort from the National Institute on Aging Late-Onset Alzheimer's Disease Family Study
21059989 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20951388 results suggest that the PICALM gene rs3851179 polymorphism may not play a major role in the development of LOAD in the Han Chinese population.
20951388 Observational study of gene-disease association. (HuGE Navigator)
20838239 This study showed the presence of picalm in endothelial cells of human brain tissue, and it suggests an increase in PICALM expression in Alzheimer disease.
20739100 Observational study of gene-disease association. (HuGE Navigator)
20738160 Polymorphism of the clusterin gene may confer symptomatic specificity in schizophrenia, whereas polymorphism of the clathrin assembly lymphoid myeloid gene does not affect susceptibility to schizophrenia.
20697030 This study confirmed in a completely independent data set that CR1, CLU, and PICALM are AD susceptibility loci in European ancestry populations.
20697030 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20674675 In this review, PICALM is a major Alzheimer's disease susceptibility gene indirectly implicated in the herpes simplex virus life cycle; PICALM binds to a protein used by the virus for nuclear egress.
20570404 While no Alzheimer Disease association was observed with single nucleotide polymorphisms, a trend of association was seen with the Picalm and Clusterin single nucleotide polymorphisms.
20570404 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20558387 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20554627 Observational study of gene-disease association. (HuGE Navigator)
20554627 These results show near-perfect replication and provide the first additional evidence that PICALM is associated with the risk of late onset alzheimer disease.
20534741 Data confirmed genetic associations for Alzheimer's disease with APOE, CLU, PICALM and CR1 SNPs.
20534741 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20460622 Observational study, meta-analysis, and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19734902 Having removed Single Nucleotide Polymorphism within the APOE, CLU and PICALM loci from the analysis, focused on those that showed the most evidence for association with Alzheimer's disease
19734902 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19450545 RNA interference-mediated knockdown of AP180 reduces the generation of Abeta1-40 and Abeta1-42, whereas CALM knockdown has no effect on Abeta generation.
18182011 Overexpression of CALM leads to the reduction of cell surface VAMP2, whereas knockdown of CALM by RNA interference results in the accumulation of surface VAMP2.
18094714 review discusses the normal structure and function of CALM and AF10, the spectrum of clinical findings seen in patients with CALM-AF10 fusions, CALM-AF10 mouse models and highlights the role of HOXA cluster gene activation in CALM-AF10 leukemia
18074379 PICALM protein might contribute to the observed phenotype.
18037964 CALM/AF10 (MLLT10) fusion protein might interfere with normal Ikaros (IKZF1)function, and thereby block lymphoid differentiation in CALM/AF10 positive leukemias.
17804713 Expression of a CALM-AF10 fusion gene leads to Hoxa cluster overexpression and acute leukemia in transgenic mice.
17597474 A novel AF10-CALM fusion transcript is reported in gamma/delta-T cell type lymphopblastic leukemia.
17170719 Presence of CALM-AF10 fusion in children with acute megakaryoblastic leukemia without Down syndrome.
17097559 Data demonstrate that the leukemia-propagating cell in murine CALM/AF10-positive acute myeloid leukemia differs from normal hematopoietic stem cells by B220 surface expression and immunoglobulin heavy chain rearrangement.
16491119 Expression of CATS was able to markedly increase the nuclear localization of CALM and of the leukemogenic fusion protein CALM/AF10
16262731 CALM plays a critical role in the regulation and orderly progression of coated bud formation at the plasma membrane.
12461747 A novel chromosomal inversion at 11q23 in acute myeloid leukemia fuses the CALM gene to the MLL gene.

AA Sequence

MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNS      1 - 70
SWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQ     71 - 140
VAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAA    141 - 210
YNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQ    211 - 280
HLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKP    281 - 350
HTSLTTAASPVSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGD    351 - 420
PFSATVDAVDDAIPSLNPFLTKSSGDVHLSISSDVSTFTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFE    421 - 490
SVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANLVGNLGIGNGTTKN    491 - 560
DVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMAPPVMAYPATTPTGMIGYGIPPQMGSVPVMTQPTLIY    561 - 630
SQPVMRPPNPFGPVSGAQIQFM                                                    631 - 652
//

Text Mined References (100)

PMID Year Title
26434199 2015 LACK OF ASSOCIATIONS BETWEEN CLU AND PICALM GENE POLYMORPHISMS AND ALZHEIMER'S DISEASE IN A TURKISH POPULATION.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25898166 2015 CALM regulates clathrin-coated vesicle size and maturation by directly sensing and driving membrane curvature.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25359311 2015 Association of MTHFR and PICALM polymorphisms with Alzheimer's disease.
25241929 2014 PICALM modulates autophagy activity and tau accumulation.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25169757 2014 An intronic PICALM polymorphism, rs588076, is associated with allelic expression of a PICALM isoform.
25022885 2014 Genetic evidence for the involvement of variants at APOE, BIN1, CR1, and PICALM loci in risk of late-onset Alzheimer's disease and evaluation for interactions with APOE genotypes.
24660791 2014 The benefits of staying active in old age: physical activity counteracts the negative influence of PICALM, BIN1, and CLU risk alleles on episodic memory functioning.
24618820 2014 Genetics of PICALM expression and Alzheimer's disease.
24613704 2014 Genetic interaction of PICALM and APOE is associated with brain atrophy and cognitive impairment in Alzheimer's disease.
24578178 2015 Impacts of PICALM and CLU variants associated with Alzheimer's disease on the functional connectivity of the hippocampus in healthy young adults.
24577224 2014 Decreased CALM expression reduces A?42 to total A? ratio through clathrin-mediated endocytosis of ?-secretase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24162737 2013 Meta-analysis of 74,046 individuals identifies 11 new susceptibility loci for Alzheimer's disease.
24095218 2014 Genetic variation in PICALM and Alzheimer's disease risk in Han Chinese.
24076290 2014 A mutation in CALM1 encoding calmodulin in familial idiopathic ventricular fibrillation in childhood and adolescence.
24067654 2013 Adaptor complex AP2/PICALM, through interaction with LC3, targets Alzheimer's APP-CTF for terminal degradation via autophagy.
23870418 2013 Alzheimer's disease risk genes and the age-at-onset phenotype.
23741335 2013 Uncoupling the functions of CALM in VAMP sorting and clathrin-coated pit formation.
23670296 2013 Detection of PICALM-MLLT10 (CALM-AF10) and outcome in children with T-lineage acute lymphoblastic leukemia.
23650005 Lack of association of CR1, PICALM and CLU gene polymorphisms with Alzheimer disease in a Polish population.
23601808 2013 Evidence that PICALM affects age at onset of Alzheimer's dementia in Down syndrome.
23589030 2013 Clathrin adaptor CALM/PICALM is associated with neurofibrillary tangles and is cleaved in Alzheimer's brains.
23572399 2013 PICALM gene rs3851179 polymorphism contributes to Alzheimer's disease in an Asian population.
23487024 2013 A CALM-derived nuclear export signal is essential for CALM-AF10-mediated leukemogenesis.
23382074 2013 A high-confidence interaction map identifies SIRT1 as a mediator of acetylation of USP22 and the SAGA coactivator complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23040034 2013 Lack of association between PICALM rs3851179 polymorphism and Alzheimer's disease in Chinese population and APOE?4-negative subgroup.
22975751 Association of GWAS top hits with late-onset Alzheimer disease in Korean population.
22952941 2012 The PICALM protein plays a key role in iron homeostasis and cell proliferation.
22952074 2012 Effect of Alzheimer's disease risk genes on trajectories of cognitive function in the Cardiovascular Health Study.
22943764 2012 Identification and confirmation of an exonic splicing enhancer variation in exon 5 of the Alzheimer disease associated PICALM gene.
22889924 2013 Genome-wide association study of Tourette's syndrome.
22888099 2013 A yeast model for amyloid-? aggregation exemplifies the role of membrane trafficking and PICALM in cytotoxicity.
22832961 2012 Genome-wide association study of Alzheimer's disease.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22715855 2012 Lack of association of the PICALM rs3851179 polymorphism with Parkinson's disease in the Greek population.
22639918 2012 Turning CALM into excitement: AP180 and CALM in endocytosis and disease.
22539578 2012 Genotype patterns at PICALM, CR1, BIN1, CLU, and APOE genes are associated with episodic memory.
22539346 2012 Role of phosphatidylinositol clathrin assembly lymphoid-myeloid leukemia (PICALM) in intracellular amyloid precursor protein (APP) processing and amyloid plaque pathogenesis.
22402018 2012 Implication of common and disease specific variants in CLU, CR1, and PICALM.
22064352 2012 CALM/AF10-positive leukemias show upregulation of genes involved in chromatin assembly and DNA repair processes and of genes adjacent to the breakpoint at 10p12.
22015308 2012 Polymorphisms of CR1, CLU and PICALM confer susceptibility of Alzheimer's disease in a southern Chinese population.
21965661 2011 Adaptor protein complex-2 (AP-2) and epsin-1 mediate protease-activated receptor-1 internalization via phosphorylation- and ubiquitination-dependent sorting signals.
21912625 2011 An exploratory study on CLU, CR1 and PICALM and Parkinson disease.
21706055 2012 The clathrin-binding domain of CALM-AF10 alters the phenotype of myeloid neoplasms in mice.
21627779 2011 The membrane-spanning 4-domains, subfamily A (MS4A) gene cluster contains a common variant associated with Alzheimer's disease.
21460841 2011 Common variants at MS4A4/MS4A6E, CD2AP, CD33 and EPHA1 are associated with late-onset Alzheimer's disease.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21358043 2011 PICALM and CR1 variants are not associated with sporadic Alzheimer's disease in Chinese patients.
21347408 2011 Fine mapping of genetic variants in BIN1, CLU, CR1 and PICALM for association with cerebrospinal fluid biomarkers for Alzheimer's disease.
21300948 2011 The role of clusterin, complement receptor 1, and phosphatidylinositol binding clathrin assembly protein in Alzheimer disease risk and cerebrospinal fluid biomarker levels.
21297266 2011 Implication of a genetic variant at PICALM in Alzheimer’s disease patients and centenarians.
21269460 2011 Initial characterization of the human central proteome.
21221849 2011 CALM, a clathrin assembly protein, influences cell surface GluR2 abundance.
21220176 2011 Evidence of the association of BIN1 and PICALM with the AD risk in contrasting European populations.
21059989 2011 Identification of novel loci for Alzheimer disease and replication of CLU, PICALM, and BIN1 in Caribbean Hispanic individuals.
20951388 2011 Genetic association of PICALM polymorphisms with Alzheimer's disease in Han Chinese.
20838239 2010 Distribution and expression of picalm in Alzheimer disease.
20739100 2011 Genetic variations in the CLU and PICALM genes are associated with cognitive function in the oldest old.
20738160 2010 Association analysis between the rs11136000 single nucleotide polymorphism in clusterin gene, rs3851179 single nucleotide polymorphism in clathrin assembly lymphoid myeloid protein gene and the patients with schizophrenia in the Chinese population.
20697030 2010 Meta-analysis confirms CR1, CLU, and PICALM as alzheimer disease risk loci and reveals interactions with APOE genotypes.
20674675 2010 APP, APOE, complement receptor 1, clusterin and PICALM and their involvement in the herpes simplex life cycle.
20570404 2012 Association of CLU and PICALM variants with Alzheimer's disease.
20558387 2010 Genetic variation and neuroimaging measures in Alzheimer disease.
20554627 2010 Replication of CLU, CR1, and PICALM associations with alzheimer disease.
20534741 2010 Association of CR1, CLU and PICALM with Alzheimer's disease in a cohort of clinically characterized and neuropathologically verified individuals.
20460622 2010 Genome-wide analysis of genetic loci associated with Alzheimer disease.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19734902 2009 Genome-wide association study identifies variants at CLU and PICALM associated with Alzheimer's disease.
19450545 2009 The clathrin assembly protein AP180 regulates the generation of amyloid-beta peptide.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18182011 2008 Evidence for CALM in directing VAMP2 trafficking.
18094714 2008 The role of CALM-AF10 gene fusion in acute leukemia.
18074379 2008 A child with deletion (14)(q24.3q32.13) and auditory neuropathy.
18037964 2008 The leukemogenic CALM/AF10 fusion protein alters the subcellular localization of the lymphoid regulator Ikaros.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17804713 2007 Expression of a CALM-AF10 fusion gene leads to Hoxa cluster overexpression and acute leukemia in transgenic mice.
17597474 2007 A novel AF10-CALM fusion transcript in gamma/delta-T cell type lymphoblastic lymphoma.
17170719 2007 High incidence of CALM-AF10 fusion and the identification of a novel fusion transcript in acute megakaryoblastic leukemia in children without Down's syndrome.
17097559 2006 Acute myeloid leukemia is propagated by a leukemic stem cell with lymphoid characteristics in a mouse model of CALM/AF10-positive leukemia.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16491119 2006 The novel CALM interactor CATS influences the subcellular localization of the leukemogenic fusion protein CALM/AF10.
16262731 2005 Effect of clathrin assembly lymphoid myeloid leukemia protein depletion on clathrin coat formation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14985334 2004 Analysis of clathrin-mediated endocytosis of epidermal growth factor receptor by RNA interference.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12461747 2003 A novel chromosomal inversion at 11q23 in infant acute myeloid leukemia fuses MLL to CALM, a gene that encodes a clathrin assembly protein.
11425879 2001 Nucleocytoplasmic shuttling of endocytic proteins.
10926122 2000 Properties of GST-CALM expressed in E. coli.
10436022 1999 Clathrin assembly lymphoid myeloid leukemia (CALM) protein: localization in endocytic-coated pits, interactions with clathrin, and the impact of overexpression on clathrin-mediated traffic.
9737689 1998 Alternative splicing in wild-type AF10 and CALM cDNAs and in AF10-CALM and CALM-AF10 fusion cDNAs produced by the t(10;11)(p13-14;q14-q21) suggests a potential role for truncated AF10 polypeptides.
8643484 1996 The t(10;11)(p13;q14) in the U937 cell line results in the fusion of the AF10 gene and CALM, encoding a new member of the AP-3 clathrin assembly protein family.
1547942 1992 CHOP, a novel developmentally regulated nuclear protein that dimerizes with transcription factors C/EBP and LAP and functions as a dominant-negative inhibitor of gene transcription.