Property Summary

NCBI Gene PubMed Count 36
PubMed Score 19.86
PubTator Score 64.06

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
posterior fossa group B ependymoma 1.400 4.7e-06
sonic hedgehog group medulloblastoma 1.700 6.3e-05
primary Sjogren syndrome 1.100 7.9e-03
ovarian cancer 1.200 3.1e-03

Gene RIF (20)

PMID Text
26634256 These data show that exposure to an allogeneic stimulus is not needed to cause a marked rise in PIBF, merely progesterone alone is sufficient.
25818991 Maternal serum progesterone-induced blocking factor (PIBF) in the prediction of preterm birth.
25218441 Progesterone-induced blocking factor is hormonally regulated in human astrocytoma cells, and increases their growth through the IL-4R/JAK1/STAT6 pathway
24474429 progesterone-induced blocking factor is intracellularly expressed by the cultured cells from Glioblastoma
24325791 reduced expression during late pregnancy and resorption
24225150 decreased kisspeptin and PIBF expressions in trophoblasts and deciduas are associated with recurrent spontaneous abortion
23807209 Data indicate that silencing of progesterone-induced blocking factor (PIBF) increased invasiveness as well as MMP-2,-9 secretion of HTR8/SVneo trophoblast, and decreased those of HT-1080 cells.
23110211 CEP90 physically interacts with PCM-1 at centriolar satellites, and this interaction is essential for centrosomal accumulation of the centriolar satellites and eventually for primary cilia formation.
22172828 Suggest that urinary PIBF levels may predict graft rejection in transplant recipients.
22032897 increased serum levels after dydrogesterone supplementation in women with threatened preterm delivery; positive correlation with the length of gestation
21632119 PIBF affects the expression of leptin and its receptor, and PIBF expression is inversely related to trophoblast invasiveness.
21224392 CEP90 was characterized as a component of pericentriolar satellites.
20367622 role of PIBF in both normal pregnancy and tumor biology [REVIEW]
19898481 Observational study of gene-disease association. (HuGE Navigator)
19371956 promotes secretion of type 2 cytkines by activated lymphocytes from pregnant woman
19290853 PIBF concentrations in urine and serum of patients with threatened abortion were significantly lower than in healthy pregnant women.
16433831 PIBF phosphorylates PKC via binding to the IL-4R, without affecting intracellular Ca(++). These findings explain the mechanism by which PIBF supports a Th2 dominant cytokine pattern.
15305375 progesterone induced blocking factor overexpression is associated with breast neoplasms
15269099 PIBF production is a characteristic feature of normal pregnancy, and determination of PIBF concentration in urine might be of use for the diagnosis of threatened premature pregnancy termination.
14634107 The 48-kDa N-terminal part of PIBF is biologically active, and the part of the molecule responsible for modulating natural killer cell activity is encoded by exons 2-4.

AA Sequence

MSRKISKESKKVNISSSLESEDISLETTVPTDDISSSEEREGKVRITRQLIERKELLHNIQLLKIELSQK      1 - 70
TMMIDNLKVDYLTKIEELEEKLNDALHQKQLLTLRLDNQLAFQQKDASKYQELMKQEMETILLRQKQLEE     71 - 140
TNLQLREKAGDVRRNLRDFELTEEQYIKLKAFPEDQLSIPEYVSVRFYELVNPLRKEICELQVKKNILAE    141 - 210
ELSTNKNQLKQLTETYEEDRKNYSEVQIRCQRLALELADTKQLIQQGDYRQENYDKVKSERDALEQEVIE    211 - 280
LRRKHEILEASHMIQTKERSELSKEVVTLEQTVTLLQKDKEYLNRQNMELSVRCAHEEDRLERLQAQLEE    281 - 350
SKKAREEMYEKYVASRDHYKTEYENKLHDELEQIRLKTNQEIDQLRNASREMYERENRNLREARDNAVAE    351 - 420
KERAVMAEKDALEKHDQLLDRYRELQLSTESKVTEFLHQSKLKSFESERVQLLQEETARNLTQCQLECEK    421 - 490
YQKKLEVLTKEFYSLQASSEKRITELQAQNSEHQARLDIYEKLEKELDEIIMQTAEIENEDEAERVLFSY    491 - 560
GYGANVPTTAKRRLKQSVHLARRVLQLEKQNSLILKDLEHRKDQVTQLSQELDRANSLLNQTQQPYRYLI    561 - 630
ESVRQRDSKIDSLTESIAQLEKDVSNLNKEKSALLQTKNQMALDLEQLLNHREELAAMKQILVKMHSKHS    631 - 700
ENSLLLTKTEPKHVTENQKSKTLNVPKEHEDNIFTPKPTLFTKKEAPEWSKKQKMKT                 701 - 757
//

Text Mined References (40)

PMID Year Title
26634256 2016 Evidence that exposure to progesterone alone is a sufficient stimulus to cause a precipitous rise in the immunomodulatory protein the progesterone induced blocking factor (PIBF).
26297806 2015 Centriolar satellites assemble centrosomal microcephaly proteins to recruit CDK2 and promote centriole duplication.
25818991 2015 Maternal serum progesterone-induced blocking factor (PIBF) in the prediction of preterm birth.
25218441 2014 Progesterone-induced blocking factor is hormonally regulated in human astrocytoma cells, and increases their growth through the IL-4R/JAK1/STAT6 pathway.
24474429 2014 Cells isolated from human glioblastoma multiforme express progesterone-induced blocking factor (PIBF).
24325791 2014 Progesterone induced blocking factor isoforms in normal and failed murine pregnancies.
24225150 2014 Expression of kisspeptin/GPR54 and PIBF/PR in the first trimester trophoblast and decidua of women with recurrent spontaneous abortion.
24165912 2013 Genome-wide association study identifies 8 novel loci associated with blood pressure responses to interventions in Han Chinese.
23807209 2013 Progesterone-induced blocking factor differentially regulates trophoblast and tumor invasion by altering matrix metalloproteinase activity.
23110211 2012 CEP90 is required for the assembly and centrosomal accumulation of centriolar satellites, which is essential for primary cilia formation.
22172828 2011 Changes of progesterone-induced blocking factor in patients after kidney transplantation.
22032897 2011 Dydrogesterone supplementation in women with threatened preterm delivery--the impact on cytokine profile, hormone profile, and progesterone-induced blocking factor.
21632119 2011 Progesterone-induced blocking factor (PIBF) and trophoblast invasiveness.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21224392 2011 The pericentriolar satellite protein CEP90 is crucial for integrity of the mitotic spindle pole.
20367622 2010 PIBF: the double edged sword. Pregnancy and tumor.
19898481 2009 Genetic variants at CD28, PRDM1 and CD2/CD58 are associated with rheumatoid arthritis risk.
19371956 2009 Progesterone-induced blocking factor (PIBF) modulates cytokine production by lymphocytes from women with recurrent miscarriage or preterm delivery.
19290853 2009 Progesterone - induced blocking factor (PIBF) and Th(1)/Th(2) cytokine in women with threatened spontaneous abortion.
18817979 2008 Human trophoblast cells express the immunomodulator progesterone-induced blocking factor.
17500595 2007 Huntingtin interacting proteins are genetic modifiers of neurodegeneration.
16433831 2006 The progesterone-induced blocking factor modulates the balance of PKC and intracellular Ca.
16393965 2006 Progesterone-induced blocking factor activates STAT6 via binding to a novel IL-4 receptor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15305375 2004 PIBF (progesterone induced blocking factor) is overexpressed in highly proliferating cells and associated with the centrosome.
15269099 2004 Urinary progesterone-induced blocking factor concentration is related to pregnancy outcome.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14654843 2003 Proteomic characterization of the human centrosome by protein correlation profiling.
14634107 2003 Molecular cloning and immunologic characterization of a novel cDNA coding for progesterone-induced blocking factor.
12733588 2003 Progesterone regulates IL12 expression in pregnancy lymphocytes by inhibiting phospholipase A2.
12516630 2002 Progesterone induced blocking factor (PIBF) mediates progesterone induced suppression of decidual lymphocyte cytotoxicity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11935316 2002 A genomic map of a 6-Mb region at 13q21-q22 implicated in cancer development: identification and characterization of candidate genes.
11407300 2001 Progesterone as an immunomodulatory molecule.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
9266004 1997 Evidence that the expression of progesterone-induced blocking factor by maternal T-lymphocytes is positively correlated with conception.
9138449 1997 Lymphocyte immunotherapy (LI) increases serum levels of progesterone induced blocking factor (PIBF).
8607938 1995 The expression of a progesterone-induced immunomodulatory protein in pregnancy lymphocytes.
3863495 1985 The mechanism of the inhibitory effect of progesterone on lymphocyte cytotoxicity: I. Progesterone-treated lymphocytes release a substance inhibiting cytotoxicity and prostaglandin synthesis.
2600930 1989 ELISA test for the detection of an immunological blocking factor in human pregnancy serum.