Property Summary

NCBI Gene PubMed Count 64
PubMed Score 50.83
PubTator Score 56.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Protein-protein Interaction (6)

Gene RIF (41)

PMID Text
26768588 PIAS3 may serve as a biomarker for predicting hormone therapy stratification, although it is limited to those breast cancer patients receiving hormone therapy.
26697750 Taken together, these results suggest that PIAS3 functions as a positive regulator of HIF-1alpha-mediated transcription by increasing its protein stability.
26667168 PIAS3 suppression may be protective against joint destruction in rheumatoid arthritis by regulating synoviocyte migration, invasion, and activation.
26565033 PIAS3 primes ATR for checkpoint activation.
26223632 Adenovirus E4-ORF3 targets PIAS3 and together with E1B-55K remodels SUMO2/SUMO3 Interactions in the nucleus and at virus genome replication domains.
26116514 HIV-1 gp120 upregulates PIAS3 expression in primary human monocyte-derived dendritic cells
25573684 PIAS3 expression in squamous cell lung cancer is low and predicts overall survival
25137041 Statistically significant positive correlation has been found between STAT5B and COX-2, and significant negative correlation between STAT5B and PIAS3.
25124686 Low PIAS3 expression in malignant mesothelioma is associated with increased STAT3 activation and poor patient survival.
25008924 HIV-1 gp120 upregulates PIAS3 expression in primary human monocyte-derived dendritic cells
24584189 this newly identified p53PIAS3 interaction through the 1-52 amino acid region of p53, reduces p53MDM2 complex formation, which not only increases the half-life of p53, but also its transactivation of target genes.
24120699 PIAS3 may be a potential biomarker target for early cancer detection and therapeutic of human colorectal cancer.
23959540 PIAS3 activates the intrinsic apoptotic pathway in non-small cell lung cancer cells independent of p53 status.
23322197 Downregulation of PIAS3 is associated with gastric adenocarcinogenesis.
22649547 NF-kappaB is regulated through a novel negative feedback mechanism by SUMOylation, where the RelA subunit of NF-kappaB is SUMOylated by PIAS3.
22584572 PIAS3 is a novel regulator of ErbB4 receptor tyrosine kinase, controlling its nuclear sequestration and function.
21733403 PIAS3 expression is closely related to the invasion properties of glioma TJ905 cells.
21532337 novel transcription factor binding partners for PIAS3 including ETS, EGR1, NR1I2, and GATA1 were identified.
21497567 Squamous cell carcinoma of the lung commonly lacks PIAS3 protein expression.
21317457 Identification of vimentin (vimentin354), a nuclear component in glioblastoma multiforme cells, as the main target of sumoylation promoted by PIAS3.
20516148 These findings indicate that TRIM8 enhances the STAT3-dependent signal pathway by inhibiting the function of PIAS3.
20231901 SOCS-3 and PIAS-3 upregulation impairs IL-12-mediated interferon-gamma response in CD56 T cells in HCV-infected heroin users
20159969 there is an interaction between Zimp7 and PIAS proteins with higher preference for PIAS3, in androgen receptor-mediated transcription
19903771 data suggest an important role for the negative regulatory effect of PIAS3 on STAT3 in EGF-driven tumors
19760037 we selected one coding single nucleotide polymorphism in PIAS3 for association analyses in patients with breast cancer
19569236 PIAS3 is expressed in NSCLC cell lines and its over-expression decreased STAT3 transcriptional activity, decreased proliferation of NSCLC cells and when used in conjunction with EGFR inhibitors, increased the anti-proliferative effects.
19308990 This study suggests a link between PIAS3 and nuclear pyruvate kinase.
18550668 parvovirus B19 NS1 protein modulates inflammatory signaling by activation of STAT3/PIAS3 in human endothelial cells
18212042 PIAS3 binds to Tel and stimulates sumoylation of K11 in the nucleus.PIAS3 may have a dual, context-dependent influence on Tel; it mediates Tel sumoylation, but it also augments Tel's repressive function in a sumoylation-independent fashion.
17987106 Both SUMO E2 conjugating enzyme Ubc9 and E3 ligase protein inhibitor of activated STAT3 (Pias3) are targets for S-nitrosation
17987106 Pias3 associates and colocalizes with Trim32, a Ubiquitin E3 ligase.
17565989 PIAS3 is a new regulator of ATF1 that regulates the ARE-mediated transcription of the ferritin H gene
17032498 overexpression of PIAS3 in lung cancer cells contributed to growth suppression and restored the drug sensitivity of the cells
16368885 Mechanisms of PIAS3 activity could pave the way toward the formulation of an antioncogenic agent for the inhibition of both STAT3 and MITF.
16098628 End-stage hepatitis c and alcoholic liver cirrhosis is characterized by impaired Stat3 DNA-binding possibly through up-regulation of Pias3.
15140884 PIAS3 may function in vivo as a modulator in suppressing the transcriptional activity of p65
15138572 Increased PIAS3 expression is associated with human cancers including lung, breast, prostate, colon-rectum, and brain tumors
14715251 In conclusion, ATBF1 can suppress the IL-6-mediated cellular response by acting together with PIAS3.
14691252 PIAS3 and Smad3 interact with each other at the endogenous protein level in mammalian cells and also in vitro, and the association occurs through the C-terminal domain of Smad3.
14630083 Up-regulation of protein inhibitor of activated STAT3 protein is associated with adult T-cell leukemia
12804609 AR and PIAS3 regulate the STAT3-mediated transcriptional activity by their physical protein-protein competition on STAT3

AA Sequence

MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKELYRRRFPRKTL      1 - 70
GPSDLSLLSLPPGTSPVGSPGPLAPIPPTLLAPGTLLGPKREVDMHPPLPQPVHPDVTMKPLPFYEVYGE     71 - 140
LIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLPGAKCDYTIQVQLRFCLCETSCPQEDYFPPN    141 - 210
LFVKVNGKLCPLPGYLPPTKNGAEPKRPSRPINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQL    211 - 280
TAGTLLQKLRAKGIRNPDHSRALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFD    281 - 350
AALYLQMNEKKPTWTCPVCDKKAPYESLIIDGLFMEILSSCSDCDEIQFMEDGSWCPMKPKKEASEVCPP    351 - 420
PGYGLDGLQYSPVQGGDPSENKKKVEVIDLTIESSSDEEDLPPTKKHCSVTSAAIPALPGSKGVLTSGHQ    421 - 490
PSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQHYGPSVITSLDEQDALGHFF    491 - 560
QYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIVAPGGALREGHGGPLPSGPSLTGCRSDIISLD      561 - 628
//

Text Mined References (69)

PMID Year Title
26768588 2016 Prognostic value of protein inhibitor of activated STAT3 in breast cancer patients receiving hormone therapy.
26697750 2016 PIAS3 enhances the transcriptional activity of HIF-1? by increasing its protein stability.
26667168 2016 Protein Inhibitor of Activated STAT3 Regulates Migration, Invasion, and Activation of Fibroblast-like Synoviocytes in Rheumatoid Arthritis.
26565033 2016 The SUMO (Small Ubiquitin-like Modifier) Ligase PIAS3 Primes ATR for Checkpoint Activation.
26223632 2015 Adenovirus E4-ORF3 Targets PIAS3 and Together with E1B-55K Remodels SUMO Interactions in the Nucleus and at Virus Genome Replication Domains.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25573684 2015 PIAS3 expression in squamous cell lung cancer is low and predicts overall survival.
25406032 2014 Modification of DBC1 by SUMO2/3 is crucial for p53-mediated apoptosis in response to DNA damage.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25137041 2014 Expression of STAT5, COX-2 and PIAS3 in correlation with NSCLC histhopathological features.
25124686 2014 Low PIAS3 expression in malignant mesothelioma is associated with increased STAT3 activation and poor patient survival.
24651376 2014 Characterization of nuclear localization and SUMOylation of the ATBF1 transcription factor in epithelial cells.
24584189 2014 p53 N?terminal binding and stabilisation by PIAS3 inhibits MDM2?induced p53 ubiquitination and regulates cell growth.
24120699 2013 PIAS3 may represent a potential biomarker for diagnosis and therapeutic of human colorectal cancer.
23959540 2014 PIAS3 activates the intrinsic apoptotic pathway in non-small cell lung cancer cells independent of p53 status.
23322197 2013 MicroRNA-18a modulates STAT3 activity through negative regulation of PIAS3 during gastric adenocarcinogenesis.
22649547 2012 NF-?B repression by PIAS3 mediated RelA SUMOylation.
22584572 2012 Protein inhibitor of activated STAT3 (PIAS3) protein promotes SUMOylation and nuclear sequestration of the intracellular domain of ErbB4 protein.
21965678 2011 SUMOylation and SUMO-interacting motif (SIM) of metastasis tumor antigen 1 (MTA1) synergistically regulate its transcriptional repressor function.
21733403 2011 [Research on the effects of PIAS3 expression on the invasion of glioma TJ905 cells].
21532337 2011 Identification of STAT3-independent regulatory effects for protein inhibitor of activated STAT3 by binding to novel transcription factors.
21497567 2011 Protein inhibitor of activated STAT3 expression in lung cancer.
21317457 2010 Sumoylation of vimentin354 is associated with PIAS3 inhibition of glioma cell migration.
20516148 2010 TRIM8 modulates STAT3 activity through negative regulation of PIAS3.
20231901 2010 Upregulation of SOCS-3 and PIAS-3 impairs IL-12-mediated interferon-gamma response in CD56 T cells in HCV-infected heroin users.
20159969 2010 A novel role for protein inhibitor of activated STAT (PIAS) proteins in modulating the activity of Zimp7, a novel PIAS-like protein, in androgen receptor-mediated transcription.
19903771 2009 The association and nuclear translocation of the PIAS3-STAT3 complex is ligand and time dependent.
19760037 2010 Polymorphisms in the UBC9 and PIAS3 genes of the SUMO-conjugating system and breast cancer risk.
19569236 2009 Cooperative interaction between protein inhibitor of activated signal transducer and activator of transcription-3 with epidermal growth factor receptor blockade in lung cancer.
19308990 2009 The SUMO-E3 ligase PIAS3 targets pyruvate kinase M2.
18550668 2008 Human parvovirus B19 NS1 protein modulates inflammatory signaling by activation of STAT3/PIAS3 in human endothelial cells.
18212042 2008 Identification of a new site of sumoylation on Tel (ETV6) uncovers a PIAS-dependent mode of regulating Tel function.
17987106 2007 Nitric oxide destabilizes Pias3 and regulates sumoylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17696781 2007 Sumoylation of the zinc finger protein ZXDC enhances the function of its transcriptional activation domain.
17565989 2007 PIAS3 interacts with ATF1 and regulates the human ferritin H gene through an antioxidant-responsive element.
17087506 2006 Human cystathionine beta-synthase is a target for sumoylation.
17066076 2006 Regulation of MBD1-mediated transcriptional repression by SUMO and PIAS proteins.
17032498 2006 Overexpression of PIAS3 suppresses cell growth and restores the drug sensitivity of human lung cancer cells in association with PI3-K/Akt inactivation.
16679534 2006 CGI-55 interacts with nuclear proteins and co-localizes to p80-coilin positive-coiled bodies in the nucleus.
16522640 2006 Interaction of protein inhibitor of activated STAT (PIAS) proteins with the TATA-binding protein, TBP.
16455055 2006 Evidence for the interaction of the regulatory protein Ki-1/57 with p53 and its interacting proteins.
16368885 2006 Identifying a common molecular mechanism for inhibition of MITF and STAT3 by PIAS3.
16098628 2005 Deficient Stat3 DNA-binding is associated with high Pias3 expression and a positive anti-apoptotic balance in human end-stage alcoholic and hepatitis C cirrhosis.
15907835 2005 PIAS proteins are involved in the SUMO-1 modification, intracellular translocation and transcriptional repressive activity of RET finger protein.
15507434 2005 Sumoylation of MITF and its related family members TFE3 and TFEB.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15208321 2004 Repression of the Transactivating Capacity of the Oncoprotein PLAG1 by SUMOylation.
15140884 2004 PIAS3 suppresses NF-kappaB-mediated transcription by interacting with the p65/RelA subunit.
15138572 2004 Differential PIAS3 expression in human malignancy.
14715251 2004 ATBF1 enhances the suppression of STAT3 signaling by interaction with PIAS3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14691252 2004 Activation of Smad transcriptional activity by protein inhibitor of activated STAT3 (PIAS3).
14630083 2004 Down-regulation of SHP1 and up-regulation of negative regulators of JAK/STAT signaling in HTLV-1 transformed cell lines and freshly transformed human peripheral blood CD4+ T-cells.
12869526 2003 HCC-associated protein HCAP1, a variant of GEMIN4, interacts with zinc-finger proteins.
12804609 2003 Molecular interactions between STAT3 and protein inhibitor of activated STAT3, and androgen receptor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12387893 2002 PIAS3 induces SUMO-1 modification and transcriptional repression of IRF-1.
12208521 2002 PIAS3 (protein inhibitor of activated STAT-3) modulates the transcriptional activation mediated by the nuclear receptor coactivator TIF2.
11709556 2002 A new role for the STAT3 inhibitor, PIAS3: a repressor of microphthalmia transcription factor.
11477070 2001 DJ-1 positively regulates the androgen receptor by impairing the binding of PIASx alpha to the receptor.
11429412 2001 Activation of estrogen receptor blocks interleukin-6-inducible cell growth of human multiple myeloma involving molecular cross-talk between estrogen receptor and STAT3 mediated by co-regulator PIAS3.
11390395 2001 Requirement for high mobility group protein HMGI-C interaction with STAT3 inhibitor PIAS3 in repression of alpha-subunit of epithelial Na+ channel (alpha-ENaC) transcription by Ras activation in salivary epithelial cells.
11117529 2000 ARIP3 (androgen receptor-interacting protein 3) and other PIAS (protein inhibitor of activated STAT) proteins differ in their ability to modulate steroid receptor-dependent transcriptional activation.
11071847 2000 Protein inhibitor of activated STAT3 regulates androgen receptor signaling in prostate carcinoma cells.
11060035 2000 The zinc finger protein Gfi-1 can enhance STAT3 signaling by interacting with the STAT3 inhibitor PIAS3.
10319586 1999 Isolation and chromosomal assignment of a human gene encoding protein inhibitor of activated STAT3 (PIAS3).
9388184 1997 Specific inhibition of Stat3 signal transduction by PIAS3.