Property Summary

NCBI Gene PubMed Count 101
PubMed Score 70.45
PubTator Score 87.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Rheumatoid Arthritis 1.200 1.9e-02
osteosarcoma -2.087 2.7e-05
atypical teratoid / rhabdoid tumor -1.500 8.2e-06
glioblastoma -1.700 2.2e-06
medulloblastoma, large-cell -1.100 3.4e-03
non-small cell lung cancer -1.327 1.8e-20
intraductal papillary-mucinous neoplasm ... 1.100 1.2e-02
lung cancer -1.400 1.9e-02
adult high grade glioma -1.100 2.3e-03
Breast cancer -1.500 1.1e-16
ovarian cancer -1.700 9.5e-10

Protein-protein Interaction (10)

Gene RIF (52)

PMID Text
27032383 PIAS1 enhances p300 recruitment to c-Myb-bound sites through interaction with both proteins. In addition, the E3 activity of PIAS1 enhances further its coactivation
26450775 Data demonstrate that PIAS1 interacts with TRF2 and mediates its sumoylation serving as a molecular switch that controls the level of TRF2 at telomeres.
26403403 the expression of SENP8, SAE1, PIAS1, PIAS2 and ZMIZ1 is deregulated in the majority of PTC tissues, likely contributing to the PTC phenotype.
26219822 Results show that apocrine breast cancer and prostate cancer cells share a core AR cistrome and target gene signature linked to cancer cell growth, and PIAS1 plays a similar coregulatory role for AR in both cancer cell types.
25895136 c-Myc is targeted to the proteasome for degradation in a SUMOylation-dependent manner, regulated by PIAS1, SENP7 and RNF4
25474038 the presented data indicate that PIAS1 is crucial for parental and docetaxel resistant prostate cancer cell survival
24911587 Our data suggest that necdin suppresses PIAS1 both by inhibiting SUMO E3 ligase activity and by promoting ubiquitin-dependent degradation.
24872413 PIAS1 is the E3 ligase responsible for SUMOylation of HMGN2.
24586797 Elevated PIAS1 expression was observed in breast tumor samples.
24174529 Phosphorylation of serine residues adjacent to the PIAS1 SUMO-interacting motif favors formation of the non covalent PIAS1.SUMO.UBC9 ternary complex
24052079 Smad2 and PIAS1 proteins were significantly upregulated resulting in dramatically increased interactions between Smad2/4 and PIAS1 in the presence of zinc.
24036127 Further study indicated that PIAS1 interacted with IRF3 and inhibited the DNA binding activity of IRF3.
23472246 Levels of STAT1 andor the protein expression of its negative regulators, PIAS1 and SOCS3, may be a good predictor of hepatitis C virus response to therapy
23202365 MAPK-activated protein kinase-2 limits endothelial inflammation via the PIAS1 S522 phosphorylation-mediated increase in PIAS1 transrepression and SUMO ligase activity.
22976298 Data suggest that the pro-apoptotic protein Daxx specifically interacts with one or more substrates SUMOylated by PIAS1 and this interaction leads to apoptosis following UV irradiation.
22972521 data suggest that PIAS1 may function as a tumor suppressor to regulate gastric cancer cell metastasis by targeting the MAPK signaling pathway
22539995 PIAS1 is a SUMO ligase for GATA4 that differentially regulates GATA4 transcriptional activity independent of SUMO ligase activity and GATA4 sumoylation.
22449952 The data reveal an important new role for PIAS1 in the regulation of cell proliferation in prostate cancer.
22283414 PIAS1 promotes SUMOylation of AIB1 and represses its transcriptional activity.
21925039 There are differences in the PIAS3 expression from different stages of gastric precancerous conditions/lesions to GC, which may reveal a close relationship between expression reduction or loss of PIAS3 and gastric tumorigenesis.
21717107 PIAS1 negatively regulates ubiquitination of Msx1 homeoprotein independent of its SUMO ligase activity.
21676946 PIAS1 determines the level of JNK activity in human endometrial stromal cells , couples ROS signaling to the SUMO pathway, and promotes oxidative cell death.
21467194 Ubc9 and PIAS1 potentiated SF-1-mediated transactivation of human CYP17, CYP11A1, and CYP11B1 but not CYP11B2 promoters.
21338522 PIAS1 is a common partner for two cancer-related nuclear factors, c-Myb and FLASH.
20711444 Pias1-dependent SUMOylation influences Gli protein activity
20351170 Data show that regulation of SATB1 sumoylation and caspase cleavage is controlled by SATB1 phosphorylation; specifically, PIAS1 interaction with SATB1 is inhibited by phosphorylation.
20209145 FOXL2 interacts with PIAS1 and UBC9, and sumoylated in both human and mouse
19604093 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19288270 PIAS1 staining of the colon cancer tissue microarrays indicated a strong correlation of normal colon cells, and adenomas, with high expression of both PIAS1 and IRF-1
18660489 Observational study of gene-disease association. (HuGE Navigator)
18190974 The data show that HCV NS3/4a is able to block the Jak-Stat signaling pathway at the stage of Stat-1 serine 727 phosphorylation.
17934332 the transcriptional repressor activity of ZNF133 is regulated by both the KRAB domain and the zinc finger motifs, and that the repressive effect by zinc finger motifs is mediated by PIAS1
17606919 PIASy cooperates with PIAS1 to down-regulate the specificity and magnitude of NF-kappa B/STAT1-mediated gene activation.
17509614 These results suggest that KyoT2 is a substrate of SUMO modification catalyzed by PIAS1, and that SUMOylation may modulate the transcriptional repression effect of KyoT2 on the Notch/RBP-J signaling pathway [Kyot2].
17371985 TGF-beta rapidly suppresses IFN-gamma-driven STAT1 signaling by reducing DNA binding via promotion of STAT1--PIAS1 interactions and not inhibition of STAT1 activation.
16600910 PIAS1 is required for the appropriate localization and retention of Msx1 at the nuclear periphery in myoblast cells.
16563226 In this study, we demonstrate that MEF2A undergoes sumoylation primarily at a single lysine residue (K395) both in vitro and in vivo. We also show that the nuclear E3 ligase, PIAS1, promotes sumoylation of MEF2A.
16144832 Pias1 binds to and sumoylates metabotropic glutamate receptor 8
16135793 PIAS1 modulates transcriptional activation of smooth muscle cells marker genes through cooperative interactions with both serum response factor and class I basic helix-loop-helix proteins proteins.
15901746 Results suggest that recombinant human interleukin-12 upregulates STAT-1 expression and that increased expression may be dose dependent.
15611122 data support a physiological role of Ubc9 and PIAS1 as transcriptional coactivators in COUP-TFI-mediated CYP11B2 transcription
15572677 PIAS1 interacts with DNA cross-link repair SNM1A in nuclear focus formation.
15572666 PIAS1 is a checkpoint regulator which affects exit from G1 and G2 by sumoylation of p73.
15337742 GATA4 is a SUMO-1-targeted transcription factor and together with PIAS1 is a potent regulator of cardiac gene activity
15133049 three-dimensional structure and its binding duality are discussed in conjunction with the biological functions of PIAS1 as a SUMO ligase
14500761 PIAS1 interacts with the N-terminal domain of human mineralocorticoid receptor and represses its ligand-dependent transcription.
12855578 found to strongly stimulate sumoylation of STAT1 at Lys703; results suggest a negative regulatory function for sumoylation.
12393906 PIAS1 has a role in sumoylation of MDM2 in the cell nucleus
12177000 PIAS1 and PIASxalpha modulate the AR-dependent transactivation, which, at least in part, can be attributed to their SUMO-E3 activity toward AR.
11877418 Protein inhibitors of activated STAT resemble scaffold attachment factors and function as interacting nuclear receptor coregulators.
11788578 protein inhibitor of activated Stat1 (PIAS1) interacts with the tetramerization and C-terminal regulatory domains of p53 in yeast two-hybrid analyses
11451946 novel function of PIAS1 in the induction of JNK-dependent apoptosis, independent of the previously known inhibitory activity of PIAS1 in STAT-mediated gene activation.

AA Sequence

MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKELYRRRFPQKIM      1 - 70
TPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQK     71 - 140
LPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCP    141 - 210
QEDHFPPNLCVKVNTKPCSLPGYLPPTKNGVEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNYSM    211 - 280
AVYLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALT    281 - 350
CSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK    351 - 420
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRTCPSLSPTSPL    421 - 490
NNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSL    491 - 560
LAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTSLPTTNGSSSGSNSSLVSSNSLRESHSHTVT    561 - 630
NRSSTDTASIFGIIPDIISLD                                                     631 - 651
//

Text Mined References (116)

PMID Year Title
27032383 2016 PIAS1 binds p300 and behaves as a coactivator or corepressor of the transcription factor c-Myb dependent on SUMO-status.
26450775 2015 PIAS1-mediated sumoylation promotes STUbL-dependent proteasomal degradation of the human telomeric protein TRF2.
26403403 PAPILLARY THYROID CANCER IS CHARACTERIZED BY ALTERED EXPRESSION OF GENES INVOLVED IN THE SUMOYLATION PROCESS.
26219822 2015 Androgen receptor- and PIAS1-regulated gene programs in molecular apocrine breast cancer cells.
25895136 2015 c-Myc is targeted to the proteasome for degradation in a SUMOylation-dependent manner, regulated by PIAS1, SENP7 and RNF4.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25474038 2014 PIAS1 is a crucial factor for prostate cancer cell survival and a valid target in docetaxel resistant cells.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24911587 2014 Necdin promotes ubiquitin-dependent degradation of PIAS1 SUMO E3 ligase.
24872413 2014 High mobility group nucleosomal binding domain 2 (HMGN2) SUMOylation by the SUMO E3 ligase PIAS1 decreases the binding affinity to nucleosome core particles.
24586797 2014 PIAS1 regulates breast tumorigenesis through selective epigenetic gene silencing.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24174529 2013 Identification of a non-covalent ternary complex formed by PIAS1, SUMO1, and UBC9 proteins involved in transcriptional regulation.
24052079 2013 PIAS1-modulated Smad2/4 complex activation is involved in zinc-induced cancer cell apoptosis.
24036127 2013 PIAS1 negatively modulates virus triggered type I IFN signaling by blocking the DNA binding activity of IRF3.
23472246 2013 The role of hepatic expression of STAT1, SOCS3 and PIAS1 in the response of chronic hepatitis C patients to therapy.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
23202365 2013 Phosphorylation of protein inhibitor of activated STAT1 (PIAS1) by MAPK-activated protein kinase-2 inhibits endothelial inflammation via increasing both PIAS1 transrepression and SUMO E3 ligase activity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22976298 2012 The SUMO ligase PIAS1 regulates UV-induced apoptosis by recruiting Daxx to SUMOylated foci.
22972521 2012 Protein inhibitor of activated STAT-1 is downregulated in gastric cancer tissue and involved in cell metastasis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22555612 2012 SUMOylation of Blimp-1 is critical for plasma cell differentiation.
22539995 2012 PIAS1 is a GATA4 SUMO ligase that regulates GATA4-dependent intestinal promoters independent of SUMO ligase activity and GATA4 sumoylation.
22449952 2012 PIAS1 is increased in human prostate cancer and enhances proliferation through inhibition of p21.
22283414 2012 The transcriptional activity of co-activator AIB1 is regulated by the SUMO E3 ligase PIAS1.
21965678 2011 SUMOylation and SUMO-interacting motif (SIM) of metastasis tumor antigen 1 (MTA1) synergistically regulate its transcriptional repressor function.
21925039 2011 The expression of protein inhibitor of activated signal transducers and activators of transcription 3 in the evolutionary process of gastric cancer.
21911577 2011 A physical interaction network of dengue virus and human proteins.
21717107 2011 PIAS1 negatively regulates ubiquitination of Msx1 homeoprotein independent of its SUMO ligase activity.
21676946 2011 The SUMO E3-ligase PIAS1 couples reactive oxygen species-dependent JNK activation to oxidative cell death.
21467194 2011 Coactivation of SF-1-mediated transcription of steroidogenic enzymes by Ubc9 and PIAS1.
21338522 2011 PIAS1 interacts with FLASH and enhances its co-activation of c-Myb.
20711444 2010 SUMOylation by Pias1 regulates the activity of the Hedgehog dependent Gli transcription factors.
20471636 2010 PIASy interacts with p73alpha and regulates cell cycle in HEK293 cells.
20351170 2010 Phosphorylation-dependent interaction of SATB1 and PIAS1 directs SUMO-regulated caspase cleavage of SATB1.
20209145 2010 The forkhead transcription factor Foxl2 is sumoylated in both human and mouse: sumoylation affects its stability, localization, and activity.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20016603 2009 Mammalian SUMO E3-ligases PIAS1 and PIAS4 promote responses to DNA double-strand breaks.
19906316 2009 Discovery of novel human transcript variants by analysis of intronic single-block EST with polyadenylation site.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19604093 2009 Genetic polymorphisms, their allele combinations and IFN-beta treatment response in Irish multiple sclerosis patients.
19288270 2009 Substantially reduced expression of PIAS1 is associated with colon cancer development.
19136629 2009 PRMT1-mediated arginine methylation of PIAS1 regulates STAT1 signaling.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18579533 2008 Regulation of cardiac specific nkx2.5 gene activity by small ubiquitin-like modifier.
18190974 2008 A screening method for identifying disruptions in interferon signaling reveals HCV NS3/4a disrupts Stat-1 phosphorylation.
17934332 2007 PIAS1 interacts with the KRAB zinc finger protein, ZNF133, via zinc finger motifs and regulates its transcriptional activity.
17696781 2007 Sumoylation of the zinc finger protein ZXDC enhances the function of its transcriptional activation domain.
17606919 2007 Control of specificity and magnitude of NF-kappa B and STAT1-mediated gene activation through PIASy and PIAS1 cooperation.
17540171 2007 Proinflammatory stimuli induce IKKalpha-mediated phosphorylation of PIAS1 to restrict inflammation and immunity.
17509614 2007 The transcriptional repression activity of KyoT2 on the Notch/RBP-J pathway is regulated by PIAS1-catalyzed SUMOylation.
17371985 2007 TGF-beta suppresses IFN-gamma-STAT1-dependent gene transcription by enhancing STAT1-PIAS1 interactions in epithelia but not monocytes/macrophages.
17369852 2007 SUMO modification of the DEAD box protein p68 modulates its transcriptional activity and promotes its interaction with HDAC1.
17283066 2007 An acetylation/deacetylation-SUMOylation switch through a phylogenetically conserved psiKXEP motif in the tumor suppressor HIC1 regulates transcriptional repression activity.
17159996 2007 Regulation of protein tyrosine phosphatase 1B by sumoylation.
17087506 2006 Human cystathionine beta-synthase is a target for sumoylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17066076 2006 Regulation of MBD1-mediated transcriptional repression by SUMO and PIAS proteins.
16679534 2006 CGI-55 interacts with nuclear proteins and co-localizes to p80-coilin positive-coiled bodies in the nucleus.
16617055 2006 Sumoylation delimits KLF8 transcriptional activity associated with the cell cycle regulation.
16600910 2006 PIAS1 confers DNA-binding specificity on the Msx1 homeoprotein.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16563226 SUMO-1 modification of MEF2A regulates its transcriptional activity.
16522640 2006 Interaction of protein inhibitor of activated STAT (PIAS) proteins with the TATA-binding protein, TBP.
16154161 2006 SUMO-1 modification of centrosomal protein hNinein promotes hNinein nuclear localization.
16144832 2005 Pias1 interaction and sumoylation of metabotropic glutamate receptor 8.
16135793 2005 PIAS1 activates the expression of smooth muscle cell differentiation marker genes by interacting with serum response factor and class I basic helix-loop-helix proteins.
15957955 2005 Novel interaction between nuclear coactivator CBP and the protein inhibitor of activated Stat1 (PIAS1).
15901746 2005 A single administration of recombinant human interleukin-12 is associated with increased expression levels of interferon-gamma and signal transducer and activator of transcription in healthy subjects.
15782135 2005 Caspase-8 sumoylation is associated with nuclear localization.
15666827 2004 COUP-TF and transcriptional co-regulators in adrenal steroidogenesis.
15666801 2004 FHL2, UBC9, and PIAS1 are novel estrogen receptor alpha-interacting proteins.
15657437 2005 Negative regulation of NF-kappaB signaling by PIAS1.
15611122 2005 Ubc9 and Protein Inhibitor of Activated STAT 1 Activate Chicken Ovalbumin Upstream Promoter-Transcription Factor I-mediated Human CYP11B2 Gene Transcription.
15588942 2004 Protein partners of C/EBPepsilon.
15580297 2005 Sumoylation of the net inhibitory domain (NID) is stimulated by PIAS1 and has a negative effect on the transcriptional activity of Net.
15572677 2004 DNA cross-link repair protein SNM1A interacts with PIAS1 in nuclear focus formation.
15572666 2004 PIAS-1 is a checkpoint regulator which affects exit from G1 and G2 by sumoylation of p73.
15572661 2004 Negative modulation of androgen receptor transcriptional activity by Daxx.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15337742 2004 SUMO-1 modification activated GATA4-dependent cardiogenic gene activity.
15280358 2004 ZNF76, a novel transcriptional repressor targeting TATA-binding protein, is modulated by sumoylation.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15208321 2004 Repression of the Transactivating Capacity of the Oncoprotein PLAG1 by SUMOylation.
15192080 2004 Small ubiquitin-like modifier 1 (SUMO-1) modification of the synergy control motif of Ad4 binding protein/steroidogenic factor 1 (Ad4BP/SF-1) regulates synergistic transcription between Ad4BP/SF-1 and Sox9.
15133049 2004 NMR structure of the N-terminal domain of SUMO ligase PIAS1 and its interaction with tumor suppressor p53 and A/T-rich DNA oligomers.
15123615 2004 Dynamin interacts with members of the sumoylation machinery.
15028714 2004 Regulation of Smad4 sumoylation and transforming growth factor-beta signaling by protein inhibitor of activated STAT1.
14752048 2004 Modification of de novo DNA methyltransferase 3a (Dnmt3a) by SUMO-1 modulates its interaction with histone deacetylases (HDACs) and its capacity to repress transcription.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701874 2003 SUMO modification of a novel MAR-binding protein, SATB2, modulates immunoglobulin mu gene expression.
14611647 2004 The negative regulator of Gli, Suppressor of fused (Sufu), interacts with SAP18, Galectin3 and other nuclear proteins.
14500761 2003 Protein inhibitor of activated signal transducer and activator of transcription 1 interacts with the N-terminal domain of mineralocorticoid receptor and represses its transcriptional activity: implication of small ubiquitin-related modifier 1 modification.
14500712 2003 PIAS1-mediated sumoylation of focal adhesion kinase activates its autophosphorylation.
12855578 2003 PIAS proteins promote SUMO-1 conjugation to STAT1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393906 2002 Sumoylation of Mdm2 by protein inhibitor of activated STAT (PIAS) and RanBP2 enzymes.
12356736 2002 Transcription factor Sp3 is silenced through SUMO modification by PIAS1.
12223491 2002 SUMO-1 modification of the C-terminal KVEKVD of Axin is required for JNK activation but has no effect on Wnt signaling.
12177000 2002 PIAS1 and PIASxalpha function as SUMO-E3 ligases toward androgen receptor and repress androgen receptor-dependent transcription.
11877418 2002 Protein inhibitors of activated STAT resemble scaffold attachment factors and function as interacting nuclear receptor coregulators.
11867732 2002 Members of the PIAS family act as SUMO ligases for c-Jun and p53 and repress p53 activity.
11788578 2002 Activation of p53 by protein inhibitor of activated Stat1 (PIAS1).
11672422 2001 LIM-domain protein cysteine- and glycine-rich protein 2 (CRP2) is a novel marker of hepatic stellate cells and binding partner of the protein inhibitor of activated STAT1.
11583632 2001 Involvement of PIAS1 in the sumoylation of tumor suppressor p53.
11451946 2001 Induction of apoptosis by protein inhibitor of activated Stat1 through c-Jun NH2-terminal kinase activation.
11439351 2001 Distinct effects of PIAS proteins on androgen-mediated gene activation in prostate cancer cells.
11117529 2000 ARIP3 (androgen receptor-interacting protein 3) and other PIAS (protein inhibitor of activated STAT) proteins differ in their ability to modulate steroid receptor-dependent transcriptional activation.
10805787 2000 Distinct roles of the NH2- and COOH-terminal domains of the protein inhibitor of activated signal transducer and activator of transcription (STAT) 1 (PIAS1) in cytokine-induced PIAS1-Stat1 interaction.
10628744 2000 Protein inhibitor of activated STAT-1 (signal transducer and activator of transcription-1) is a nuclear receptor coregulator expressed in human testis.
9724754 1998 Inhibition of Stat1-mediated gene activation by PIAS1.
9177271 1997 Cloning and characterization of Gu/RH-II binding protein.