Property Summary

NCBI Gene PubMed Count 9
PubMed Score 55.51
PubTator Score 11.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.400 4.9e-04
astrocytic glioma -1.100 1.7e-03
atypical teratoid / rhabdoid tumor -1.700 1.9e-04
ependymoma -1.500 6.2e-03
glioblastoma -1.300 3.9e-05
group 3 medulloblastoma -1.100 2.1e-02
medulloblastoma, large-cell -2.300 1.7e-05
pituitary cancer 1.500 1.2e-06

Synonym

Accession Q8IYJ0 A8K0T3 B3KPF7 B3KRI6 Q6UX35
Symbols PANP
LEDA1
leda-1
C12orf53

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MESRMWPALLLSHLLPLWPLLLLPLPPPAQGSSSSPRTPPAPARPPCARGGPSAPRHVCVWERAPPPSRS      1 - 70
PRVPRSRRQVLPGTAPPATPSGFEEGPPSSQYPWAIVWGPTVSREDGGDPNSANPGFLDYGFAAPHGLAT     71 - 140
PHPNSDSMRGDGDGLILGEAPATLRPFLFGGRGEGVDPQLYVTITISIIIVLVATGIIFKFCWDRSQKRR    141 - 210
RPSGQQGALRQEESQQPLTDLSPAGVTVLGAFGDSPTPTPDHEEPRGGPRPGMPHPKGAPAFQLNRIPLV    211 - 280
NL                                                                        281 - 282
//

Text Mined References (10)

PMID Year Title