Property Summary

Ligand Count 7
NCBI Gene PubMed Count 51
PubMed Score 71.33
PubTator Score 40.85

Knowledge Summary

Patent (3,967)

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 9.2e-07
osteosarcoma 7950 3.9e-05
psoriasis 6694 5.2e-05
oligodendroglioma 2850 6.8e-03
ependymoma 4679 2.1e-02
astrocytoma 1146 4.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 1.100 4.4e-02
ependymoma 1.100 2.1e-02
oligodendroglioma 1.200 6.8e-03
osteosarcoma -1.273 3.9e-05
ovarian cancer 1.700 9.2e-07
psoriasis 1.600 5.2e-05

PDB (15)

Gene RIF (29)

AA Sequence

MGDTVVEPAPLKPTSEPTSGPPGNNGGSLLSVITEGVGELSVIDPEVAQKACQEVLEKVKLLHGGVAVSS      1 - 70
RGTPLELVNGDGVDSEIRCLDDPPAQIREEEDEMGAAVASGTAKGARRRRQNNSAKQSWLLRLFESKLFD     71 - 140
ISMAISYLYNSKEPGVQAYIGNRLFCFRNEDVDFYLPQLLNMYIHMDEDVGDAIKPYIVHRCRQSINFSL    141 - 210
QCALLLGAYSSDMHISTQRHSRGTKLRKLILSDELKPAHRKRELPSLSPAPDTGLSPSKRTHQRSKSDAT    211 - 280
ASISLSSNLKRTASNPKVENEDEELSSSTESIDNSFSSPVRLAPEREFIKSLMAIGKRLATLPTKEQKTQ    281 - 350
RLISELSLLNHKLPARVWLPTAGFDHHVVRVPHTQAVVLNSKDKAPYLIYVEVLECENFDTTSVPARIPE    351 - 420
NRIRSTRSVENLPECGITHEQRAGSFSTVPNYDNDDEAWSVDDIGELQVELPEVHTNSCDNISQFSVDSI    421 - 490
TSQESKEPVFIAAGDIRRRLSEQLAHTPTAFKRDPEDPSAVALKEPWQEKVRRIREGSPYGHLPNWRLLS    491 - 560
VIVKCGDDLRQELLAFQVLKQLQSIWEQERVPLWIKPYKILVISADSGMIEPVVNAVSIHQVKKQSQLSL    561 - 630
LDYFLQEHGSYTTEAFLSAQRNFVQSCAGYCLVCYLLQVKDRHNGNILLDAEGHIIHIDFGFILSSSPRN    631 - 700
LGFETSAFKLTTEFVDVMGGLDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIR    701 - 770
NLKERFHMSMTEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGIM                            771 - 816
//

Text Mined References (60)

PMID Year Title