Property Summary

NCBI Gene PubMed Count 47
PubMed Score 67.39
PubTator Score 40.85

Knowledge Summary

Patent (3,967)

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 9.2e-07
osteosarcoma 7933 3.9e-05
psoriasis 6685 5.2e-05
oligodendroglioma 2849 2.2e-03
ependymoma 2514 1.1e-02
astrocytoma 1493 4.4e-02
Disease Target Count Z-score Confidence
Poliomyelitis 11 3.609 1.8
Severe acute respiratory syndrome 26 3.242 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma 1.200 1.1e-02
oligodendroglioma 1.300 2.2e-03
psoriasis 1.600 5.2e-05
osteosarcoma -1.273 3.9e-05
astrocytoma 1.100 4.4e-02
ovarian cancer 1.700 9.2e-07

Protein-protein Interaction (2)

Gene RIF (25)

PMID Text
25410869 Although human rhinovirus 3A protein was previously shown to interact with ACBD3, these data suggest that PI4KIIIbeta recruitment occurred independently of both GBF1 and ACBD3.
24962317 PI4KIIIbeta likely plays a role in breast oncogenesis and that cooperation between Rab11a and PI4KIIIbeta represents a novel Akt activation pathway.
24876499 these data provide a mechanism for how PI4KIIIbeta coordinates Rab11 and its effectors on PI4P-enriched membranes and also provide strategies for the design of specific inhibitors that could potentially target plasmodial PI4KIIIbeta to combat malaria.
24792752 Authors found that NS5A and PI4KB competed for association of acyl-coenzyme A binding domain containing protein 3 (ACBD3), which inhibited hepatitis C virus replication.
24672044 Host ACBD3, PI4KIIIBETA and Aichi virus proteins complexes enhances phosphatidylinositol 4-phosphate synthesis and is critical for viral replication.
24527995 These results suggest that poliovirus proteins modulate PI4KB activity and provide PI4P for recruitment of OSBP to accumulate unesterified cholesterol on virus-induced membrane structure for formation of a virus replication complex.
23258225 The lipid kinase PI4KIIIbeta preserves lysosomal identity.
22359663 During authentic HCV infection, PI4P plays an integral role in virus replication; the vesicular transport proteins ARF1 and GBF1 colocalized with PI4KIIIbeta and were both required for HCV replication.
22258260 The 3A protein of picornaviruses utilizes the golgi adaptor protein ACBD3 to recruit PI4KIIIbeta.
22253445 Phosphatidylinositol 4-kinase IIIbeta is required for severe acute respiratory syndrome coronavirus spike-mediated cell entry.
22124328 results indicate that a viral protein/ACBD3/PI4KB complex is formed to synthesize PI4P at the AiV RNA replication sites and plays an essential role in viral RNA replication
21851817 The PI4KIIIbeta likely plays an important role in mammary neoplasia and acinar development.
21810903 Our data establish PtdIns(4,5)P(2) as a direct activator of TRPV6 and demonstrate that intracellular ATP regulates the channel indirectly as a substrate for type III PI4Ks
21330372 Study identify the molecular chaperone Hsp90 as a binding partner of PI4KIIbeta, but not of PI4KIIalpha.
21218173 Knockdown of PI4KIIalpha does not inhibit EGF-stimulated Akt phosphorylation.
19608626 our library screening completed data on the clathrin-mediated endocytosis-dependant entry route of HCV and identified 2 kinases, PI4KIIIalpha and beta, as relevant potential therapeutic targets.
19605471 genetic or pharmacological modulation of PI4KA and PI4KB inhibits multiple genotypes of HCV
19204726 Observational study of gene-disease association. (HuGE Navigator)
18474610 Work suggests an important role for both eEF1A2 and PI4KIIIbeta in the control of PI(4,5)P(2) signaling and actin remodeling.
17555516 PI4KIIalpha or PI4KIIbeta knockdown, but not type III PI4Kbeta knockdown, inhibits Listeria internalization.
17088255 there is a physical and functional relationship between eEF1A2 and PI4KIIIbeta
17003043 PI 4-kinase beta is a key enzyme in the control of spingomyelin synthesis by controlling the flow of ceramide from the ER to the Golgi compartment
15634669 PI4KIIIbeta (PIK4CB) and PI4KIIalpha (PIK4CA) localize to discrete subcompartments of the Golgi complex in Madin-Darby canine kidney (MDCK) cells.
12324459 determination that the enzyme is primarily cytosolic, and it associates peripherally with plasma membranes, endoplasmic reticulum, and the Golgi
11923287 Characterization of type II phosphatidylinositol 4-kinase isoforms reveals association of the enzymes with endosomal vesicular compartments

AA Sequence

MGDTVVEPAPLKPTSEPTSGPPGNNGGSLLSVITEGVGELSVIDPEVAQKACQEVLEKVKLLHGGVAVSS      1 - 70
RGTPLELVNGDGVDSEIRCLDDPPAQIREEEDEMGAAVASGTAKGARRRRQNNSAKQSWLLRLFESKLFD     71 - 140
ISMAISYLYNSKEPGVQAYIGNRLFCFRNEDVDFYLPQLLNMYIHMDEDVGDAIKPYIVHRCRQSINFSL    141 - 210
QCALLLGAYSSDMHISTQRHSRGTKLRKLILSDELKPAHRKRELPSLSPAPDTGLSPSKRTHQRSKSDAT    211 - 280
ASISLSSNLKRTASNPKVENEDEELSSSTESIDNSFSSPVRLAPEREFIKSLMAIGKRLATLPTKEQKTQ    281 - 350
RLISELSLLNHKLPARVWLPTAGFDHHVVRVPHTQAVVLNSKDKAPYLIYVEVLECENFDTTSVPARIPE    351 - 420
NRIRSTRSVENLPECGITHEQRAGSFSTVPNYDNDDEAWSVDDIGELQVELPEVHTNSCDNISQFSVDSI    421 - 490
TSQESKEPVFIAAGDIRRRLSEQLAHTPTAFKRDPEDPSAVALKEPWQEKVRRIREGSPYGHLPNWRLLS    491 - 560
VIVKCGDDLRQELLAFQVLKQLQSIWEQERVPLWIKPYKILVISADSGMIEPVVNAVSIHQVKKQSQLSL    561 - 630
LDYFLQEHGSYTTEAFLSAQRNFVQSCAGYCLVCYLLQVKDRHNGNILLDAEGHIIHIDFGFILSSSPRN    631 - 700
LGFETSAFKLTTEFVDVMGGLDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIR    701 - 770
NLKERFHMSMTEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGIM                            771 - 816
//

Text Mined References (56)

PMID Year Title
25410869 2015 GBF1- and ACBD3-independent recruitment of PI4KIII? to replication sites by rhinovirus 3A proteins.
24962317 2014 The lipid kinase PI4KIII? is highly expressed in breast tumors and activates Akt in cooperation with Rab11a.
24876499 2014 Structures of PI4KIII? complexes show simultaneous recruitment of Rab11 and its effectors.
24792752 2014 Hepatitis C virus NS5A competes with PI4KB for binding to ACBD3 in a genotype-dependent manner.
24672044 2014 A complex comprising phosphatidylinositol 4-kinase III?, ACBD3, and Aichi virus proteins enhances phosphatidylinositol 4-phosphate synthesis and is critical for formation of the viral replication complex.
24527995 2014 Phosphatidylinositol-4 kinase III beta and oxysterol-binding protein accumulate unesterified cholesterol on poliovirus-induced membrane structure.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
24008843 2013 Structure homology and interaction redundancy for discovering virus-host protein interactions.
23572552 2013 ACBD3 interaction with TBC1 domain 22 protein is differentially affected by enteroviral and kobuviral 3A protein binding.
23258225 2013 The lipid kinase PI4KIII? preserves lysosomal identity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22359663 2012 ARF1 and GBF1 generate a PI4P-enriched environment supportive of hepatitis C virus replication.
22258260 2012 The 3A protein from multiple picornaviruses utilizes the golgi adaptor protein ACBD3 to recruit PI4KIII?.
22253445 2012 Phosphatidylinositol 4-kinase III? is required for severe acute respiratory syndrome coronavirus spike-mediated cell entry.
22124328 2012 ACBD3-mediated recruitment of PI4KB to picornavirus RNA replication sites.
21851817 2011 The lipid kinase PI4KIII? and the eEF1A2 oncogene co-operate to disrupt three-dimensional in vitro acinar morphogenesis.
21810903 2011 Intracellular ATP supports TRPV6 activity via lipid kinases and the generation of PtdIns(4,5) P?.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21330372 2011 Stabilization of phosphatidylinositol 4-kinase type IIbeta by interaction with Hsp90.
21269460 2011 Initial characterization of the human central proteome.
21218173 2010 Differential effects of the phosphatidylinositol 4-kinases, PI4KII? and PI4KIII?, on Akt activation and apoptosis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608626 2009 Kinases required in hepatitis C virus entry and replication highlighted by small interference RNA screening.
19605471 2009 Class III phosphatidylinositol 4-kinase alpha and beta are novel host factor regulators of hepatitis C virus replication.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18474610 2008 Eukaryotic elongation factor 1A2 cooperates with phosphatidylinositol-4 kinase III beta to stimulate production of filopodia through increased phosphatidylinositol-4,5 bisphosphate generation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17555535 2007 Specificity, promiscuity and localization of ARF protein interactions with NCS-1 and phosphatidylinositol-4 kinase-III beta.
17555516 2007 Type II phosphatidylinositol 4-kinases promote Listeria monocytogenes entry into target cells.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17088255 2007 Binding of elongation factor eEF1A2 to phosphatidylinositol 4-kinase beta stimulates lipid kinase activity and phosphatidylinositol 4-phosphate generation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17003043 2006 Phosphatidylinositol 4-kinase IIIbeta regulates the transport of ceramide between the endoplasmic reticulum and Golgi.
16912074 2006 Phospho-specific binding of 14-3-3 proteins to phosphatidylinositol 4-kinase III beta protects from dephosphorylation and stabilizes lipid kinase activity.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15634669 2005 Distinct Golgi populations of phosphatidylinositol 4-phosphate regulated by phosphatidylinositol 4-kinases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14607934 2003 Neuronal calcium sensor-1 and phosphatidylinositol 4-kinase beta regulate IgE receptor-triggered exocytosis in cultured mast cells.
12749687 2003 Mammalian phosphatidylinositol 4-kinases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12324459 2002 Type II phosphatidylinositol 4-kinase beta is a cytosolic and peripheral membrane protein that is recruited to the plasma membrane and activated by Rac-GTP.
12244129 2002 Neuronal calcium sensor 1 and phosphatidylinositol 4-OH kinase beta interact in neuronal cells and are translocated to membranes during nucleotide-evoked exocytosis.
11923287 2002 Characterization of type II phosphatidylinositol 4-kinase isoforms reveals association of the enzymes with endosomal vesicular compartments.
11526106 2001 Interaction of neuronal calcium sensor-1 (NCS-1) with phosphatidylinositol 4-kinase beta stimulates lipid kinase activity and affects membrane trafficking in COS-7 cells.
11277933 2001 Human phosphatidylinositol 4-kinase isoform PI4K92. Expression of the recombinant enzyme and determination of multiple phosphorylation sites.
10559940 1999 ARF mediates recruitment of PtdIns-4-OH kinase-beta and stimulates synthesis of PtdIns(4,5)P2 on the Golgi complex.
9584208 1998 A role for a wortmannin-sensitive phosphatidylinositol-4-kinase in the endocytosis of muscarinic cholinergic receptors.
9405938 1997 Complementary DNA cloning and chromosomal mapping of a novel phosphatidylinositol kinase gene.
9405935 1997 Identification and characterization of a novel human phosphatidylinositol 4-kinase.
9148941 1997 Subcellular locations of phosphatidylinositol 4-kinase isoforms.
9020160 1997 Cloning and characterization of a wortmannin-sensitive human phosphatidylinositol 4-kinase.