Property Summary

NCBI Gene PubMed Count 2
PubMed Score 27.90

Knowledge Summary

Patent

No data available

Synonym

Accession Q8N8J0
Symbols

Gene

PANTHER Protein Class (2)

AA Sequence

MTVEQKFGLFSAEIKEADPLAASEASQPKPCPPEVTPHYIWIDFLVQRFEIAKYCSSDQVEIFSSLLQRS      1 - 70
MSLNIGGAKGSMNRHVAAIGPRFKLLTLGLSLLHADVVPNATIRNVLREKIYSTAFDYFSCPPKFPTQGE     71 - 140
KRLREDISIMIKFWTAMFSDKKYLTASQLVPPADIGDLREQLVEENTGSLSGPAKDFYQREFDFFNKITN    141 - 210
VSAVIKPYPKGDQRKKACLSALSEVTVQPGCSLPSNPEAIVLDVDYKSGTPM                      211 - 262
//

Text Mined References (3)

PMID Year Title