Property Summary

NCBI Gene PubMed Count 10
PubMed Score 10.20
PubTator Score 5.05

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
Atopic dermatitis -1.600 5.7e-05
breast carcinoma -1.500 2.7e-03
ductal carcinoma in situ -1.500 5.7e-03
inflammatory breast cancer -1.600 1.1e-02
invasive ductal carcinoma -1.400 3.0e-02
lung adenocarcinoma -1.400 4.4e-07
osteosarcoma 1.355 1.2e-02
posterior fossa group A ependymoma 1.500 7.2e-08

Gene RIF (3)

AA Sequence

MHGSCSFLMLLLPLLLLLVATTGPVGALTDEEKRLMVELHNLYRAQVSPTASDMLHMRWDEELAAFAKAY      1 - 70
ARQCVWGHNKERGRRGENLFAITDEGMDVPLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERI     71 - 140
GCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYHCKNSLCEPIGSPEDAQDLP    141 - 210
YLVTEAPSFRATEASDSRKMGTPSSLATGIPAFLVTEVSGSLATKALPAVETQAPTSLATKDPPSMATEA    211 - 280
PPCVTTEVPSILAAHSLPSLDEEPVTFPKSTHVPIPKSADKVTDKTKVPSRSPENSLDPKMSLTGARELL    281 - 350
PHAQEEAEAEAELPPSSEVLASVFPAQDKPGELQATLDHTGHTSSKSLPNFPNTSATANATGGRALALQS    351 - 420
SLPGAEGPDKPSVVSGLNSGPGHVWGPLLGLLLLPPLVLAGIF                               421 - 463
//

Text Mined References (14)

PMID Year Title