Property Summary

NCBI Gene PubMed Count 8
PubMed Score 14.41
PubTator Score 7.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Atopic dermatitis 2.000 3.4e-05
atypical teratoid / rhabdoid tumor 1.200 4.6e-02
Breast cancer -2.100 2.0e-09
breast carcinoma -2.500 9.8e-13
colon cancer -1.500 1.7e-02
cystic fibrosis 1.100 6.3e-03
Endometriosis -1.991 3.7e-02
head and neck cancer 1.400 4.4e-02
head and neck cancer and chronic obstruc... 1.600 1.4e-02
interstitial cystitis 2.300 1.6e-03
lung cancer 1.500 2.1e-03
non-small cell lung cancer 1.950 4.2e-11
osteosarcoma 1.152 1.4e-02
pituitary cancer -1.200 1.4e-04
psoriasis 1.600 1.8e-18
ulcerative colitis 4.100 1.3e-03

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MIAISAVSSALLFSLLCEASTVVLLNSTDSSPPTNNFTDIEAALKAQLDSADIPKARRKRYISQNDMIAI      1 - 70
LDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHGPSYLLRFLGQNLSVRTGRYRSILQLVK     71 - 140
PWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCN    141 - 210
YAPKGNWIGEAPYKVGVPCSSCPPSYGGSCTDNLCFPGVTSNYLYWFK                          211 - 258
//

Text Mined References (11)

PMID Year Title