Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.25
PubTator Score 5.67

Knowledge Summary


No data available


  Disease (2)


  Differential Expression (5)

Disease log2 FC p
osteosarcoma -2.017 5.6e-05
tuberculosis 1.500 1.8e-06
non-small cell lung cancer -1.074 5.7e-18
subependymal giant cell astrocytoma 1.340 5.4e-03
ovarian cancer -1.100 1.5e-05

Gene RIF (2)

23242558 Phosphohydroxylysinuria is due to mutations in the AGXT2L2 gene and the resulting lack of activity of phosphohydroxylysine phospholyase in vivo.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

NARQVVAKLDAILTDMEEKVRSCETLRLQP                                            421 - 450

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23242558 2013 Mutations in the AGXT2L2 gene cause phosphohydroxylysinuria.
22241472 2012 Molecular identification of hydroxylysine kinase and of ammoniophospholyases acting on 5-phosphohydroxy-L-lysine and phosphoethanolamine.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.