Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.44
PubTator Score 1.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
Rheumatoid Arthritis 1.300 1.7e-02
Waldenstrons macroglobulinemia 1.274 1.1e-02
Multiple myeloma 1.106 1.4e-02
malignant mesothelioma 1.800 3.5e-07
osteosarcoma 3.260 7.6e-04
group 4 medulloblastoma 2.100 4.5e-04
cystic fibrosis -1.023 3.9e-03
atypical teratoid / rhabdoid tumor 1.800 1.3e-05
glioblastoma 1.700 2.3e-03
medulloblastoma, large-cell 2.300 3.8e-07
Duchenne muscular dystrophy -1.497 1.2e-04
autosomal dominant Emery-Dreifuss muscul... -1.275 1.9e-02
hereditary spastic paraplegia -2.342 6.5e-04
limb girdle muscular dystrophy 2B -1.505 2.0e-04
acute quadriplegic myopathy -1.395 1.5e-05
adrenocortical carcinoma 1.377 8.3e-06
tuberculosis and treatment for 6 months 1.500 7.7e-06
non-small cell lung cancer 1.020 3.8e-17
Breast cancer -2.300 2.8e-02
primary Sjogren syndrome 1.300 1.1e-03
spina bifida -1.019 3.2e-02
gastric carcinoma 1.300 6.3e-03
dermatomyositis -2.400 1.4e-03

Pathway (1)

Protein-protein Interaction (6)

AA Sequence

MASKVTDAIVWYQKKEFLSVATTAPGPQQVLPGYCQCSLKDQGLFIQCLIGAYDQQIWEKSVEQREIKFI      1 - 70
KLGLRNKPKKTAHVKPDLIDVDLVRGSAFAKAKPESPWTSLTRKGIVRVVFFPFFFRWWLQVTSKVIFFW     71 - 140
LLVLYLLQVAAIVLFCSTSSPHSIPLTEVIGPIWLMLLLGTVHCQIVSTRTPKPPLSTGGKRRRKLRKAA    141 - 210
HLEVHREGDGSSTTDNTQEGAVQNHGTSTSHSVGTVFRDLWHAAFFLSGSKKAKNSIDKSTETDNGYVSL    211 - 280
DGKKTVKSGEDGIQNHEPQCETIRPEETAWNTGTLRNGPSKDTQRTITNVSDEVSSEEGPETGYSLRRHV    281 - 350
DRTSEGVLRNRKSHHYKKHYPNEDAPKSGTSCSSRCSSSRQDSESARPESETEDVLWEDLLHCAECHSSC    351 - 420
TSETDVENHQINPCVKKEYRDDPFHQSHLPWLHSSHPGLEKISAIVWEGNDCKKADMSVLEISGMIMNRV    421 - 490
NSHIPGIGYQIFGNAVSLILGLTPFVFRLSQATDLEQLTAHSASELYVIAFGSNEDVIVLSMVIISFVVR    491 - 560
VSLVWIFFFLLCVAERTYKQRLLFAKLFGHLTSARRARKSEVPHFRLKKVQNIKMWLSLRSYLKRRGPQR    561 - 630
SVDVIVSSAFLLTISVVFICCAQLLHVHEIFLDCHYNWELVIWCISLTLFLLRFVTLGSETSKKYSNTSI    631 - 700
LLTEQINLYLKMEKKPNKKEELTLVNNVLKLATKLLKELDSPFRLYGLTMNPLLYNITQVVILSAVSGVI    701 - 770
SDLLGFNLKLWKIKS                                                           771 - 785
//

Text Mined References (17)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23064961 2013 GWAS of dental caries patterns in the permanent dentition.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10729229 2000 Molecular characterization of a novel gene family (PHTF) conserved from Drosophila to mammals.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.