Property Summary

NCBI Gene PubMed Count 19
PubMed Score 23.99
PubTator Score 3.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Lupus Erythematosus, Systemic 73
Disease Target Count P-value
osteosarcoma 7933 1.5e-06
Disease Target Count Z-score Confidence
systemic lupus erythematosus 172 3.414 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.556 1.5e-06

Gene RIF (10)

PMID Text
25855964 Results suggest that PHRF1 may combine with H3K36 methylation and NBS1 to promote NHEJ and stabilize genomic integrity upon DNA damage insults.
23911286 The PHRF1 gene is deleted or silenced in a high proportion of human breast cancer samples and cancer cell lines.
22433914 we independently replicated the association of PHRF1 SNP rs4963128T with anti-Sm antibody recently reported in African- American populations, and also detected association with the presence of renal disorder.
21068098 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20962850 Observational study of gene-disease association. (HuGE Navigator)
20881011 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20848568 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20112359 Observational study of gene-disease association. (HuGE Navigator)
18204446 Genome-wide association study of gene-disease association. (HuGE Navigator)
18204446 study presents four new regions having genetic associations with systemic lupus erythematosus in women of European descent: ITGAM, KIAA1542, PXK and rs10798269

AA Sequence

MDDDSLDELVARSPGPDGHPQVGPADPAGDFEESSVGSSGDSGDDSDSEHGDGTDGEDEGASEEEDLEDR      1 - 70
SGSEDSEDDGETLLEVAGTQGKLEAAGSFNSDDDAESCPICLNAFRDQAVGTPENCAHYFCLDCIVEWSK     71 - 140
NANSCPVDRTLFKCICIRAQFGGKILRKIPVENTKASEEEEDPTFCEVCGRSDREDRLLLCDGCDAGYHM    141 - 210
ECLDPPLQEVPVDEWFCPECAAPGVVLAADAGPVSEEEVSLLLADVVPTTSRLRPRAGRTRAIARTRQSE    211 - 280
RVRATVNRNRISTARRVQHTPGRLGSSLLDEAIEAVATGLSTAVYQRPLTPRTPARRKRKTRRRKKVPGR    281 - 350
KKTPSGPSAKSKSSATRSKKRQHRVKKRRGKKVKSEATTRSRIARTLGLRRPVHSSCIPSVLKPVEPSLG    351 - 420
LLRADIGAASLSLFGDPYELDPFDSSEELSANPLSPLSAKRRALSRSALQSHQPVARPVSVGLSRRRLPA    421 - 490
AVPEPDLEEEPVPDLLGSILSGQSLLMLGSSDVIIHRDGSLSAKRAAPVSFQRNSGSLSRGEEGFKGCLQ    491 - 560
PRALPSGSPAQGPSGNRPQSTGLSCQGRSRTPARTAGAPVRLDLPAAPGAVQARNLSNGSVPGFRQSHSP    561 - 630
WFNGTNKHTLPLASAASKISSRDSKPPCRSVVPGPPLKPAPRRTDISELPRIPKIRRDDGGGRRDAAPAH    631 - 700
GQSIEIPSACISRLTGREGTGQPGRGTRAESEASSRVPREPGVHTGSSRPPAPSSHGSLAPLGPSRGKGV    701 - 770
GSTFESFRINIPGNMAHSSQLSSPGFCNTFRPVDDKEQRKENPSPLFSIKKTKQLRSEVYDPSDPTGSDS    771 - 840
SAPGSSPERSGPGLLPSEITRTISINSPKAQTVQAVRCVTSYTVESIFGTEPEPPLGPSSAMSKLRGAVA    841 - 910
AEGASDTEREEPTESQGLAARLRRPSPPEPWDEEDGASCSTFFGSEERTVTCVTVVEPEAPPSPDVLQAA    911 - 980
THRVVELRPPSRSRSTSSSRSRKKAKRKRVSREHGRTRSGTRSESRDRSSRSASPSVGEERPRRQRSKAK    981 - 1050
SRRSSSDRSSSRERAKRKKAKDKSREHRRGPWGHSRRTSRSRSGSPGSSSYEHYESRKKKKRRSASRPRG   1051 - 1120
RECSPTSSLERLCRHKHQRERSHERPDRKESVAWPRDRRKRRSRSPSSEHRAREHRRPRSREKWPQTRSH   1121 - 1190
SPERKGAVREASPAPLAQGEPGREDLPTRLPALGEAHVSPEVATADKAPLQAPPVLEVAAECEPDDLDLD   1191 - 1260
YGDSVEAGHVFDDFSSDAVFIQLDDMSSPPSPESTDSSPERDFPLKPALPPASLAVAAIQREVSLMHDED   1261 - 1330
PSQPPPLPEGTQEPHLLRPDAAEKAEAPSSPDVAPAGKEDSPSASGRVQEAARPEEVVSQTPLLRSRALV   1331 - 1400
KRVTWNLQESESSAPAEDRAPRAPLHRPQKPREGAWDMEDVAPTGVRQVFSELPFPSHVLPEPGFPDTDP   1401 - 1470
SQVYSPGLPPAPAQPSSIPPCALVSQPTVQFILQGSLPLVGCGAAQTLAPVPAALTPASEPASQATAASN   1471 - 1540
SEEKTPAPRLAAEKTKKEEYMKKLHMQERAVEEVKLAIKPFYQKREVTKEEYKDILRKAVQKICHSKSGE   1541 - 1610
INPVKVANLVKAYVDKYRHMRRHKKPEAGEEPPTQGAEG                                  1611 - 1649
//

Text Mined References (27)

PMID Year Title
25855964 2015 PHRF1 promotes genome integrity by modulating non-homologous end-joining.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23911286 2013 Identification of PHRF1 as a tumor suppressor that promotes the TGF-? cytostatic program through selective release of TGIF-driven PML inactivation.
23740937 2013 A systemic sclerosis and systemic lupus erythematosus pan-meta-GWAS reveals new shared susceptibility loci.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22433914 2012 Association of PHRF1-IRF7 region polymorphism with clinical manifestations of systemic lupus erythematosus in a Japanese population.
21408207 2011 Differential genetic associations for systemic lupus erythematosus based on anti-dsDNA autoantibody production.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21068098 2011 Study of the common genetic background for rheumatoid arthritis and systemic lupus erythematosus.
20962850 2011 A targeted association study in systemic lupus erythematosus identifies multiple susceptibility alleles.
20881011 2011 Early disease onset is predicted by a higher genetic risk for lupus and is associated with a more severe phenotype in lupus patients.
20848568 2010 Genetically determined Amerindian ancestry correlates with increased frequency of risk alleles for systemic lupus erythematosus.
20112359 2010 Genetic variation at the IRF7/PHRF1 locus is associated with autoantibody profile and serum interferon-alpha activity in lupus patients.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18204446 2008 Genome-wide association scan in women with systemic lupus erythematosus identifies susceptibility variants in ITGAM, PXK, KIAA1542 and other loci.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10997877 2000 Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.