Property Summary

NCBI Gene PubMed Count 37
PubMed Score 34.72
PubTator Score 20.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Bruxism 17 3.352 1.7

Expression

Gene RIF (15)

AA Sequence

MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCD      1 - 70
CECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY                    71 - 125
//

Text Mined References (44)

PMID Year Title