Property Summary

NCBI Gene PubMed Count 33
PubMed Score 16.06
PubTator Score 16.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma 1.700 4.5e-06
posterior fossa group A ependymoma -1.400 3.2e-14
psoriasis -1.100 4.8e-03
osteosarcoma -1.300 5.9e-03
glioblastoma -1.300 1.9e-06
atypical teratoid / rhabdoid tumor -1.100 1.5e-07
group 3 medulloblastoma -1.300 1.8e-04
medulloblastoma, large-cell -1.400 5.4e-06
intraductal papillary-mucinous adenoma (... -1.100 2.0e-03
colon cancer -2.300 1.4e-05
lung cancer 1.100 8.9e-04
active Crohn's disease -1.509 1.5e-02
ulcerative colitis -2.700 2.3e-08
pediatric high grade glioma -1.300 3.0e-08
subependymal giant cell astrocytoma -1.966 2.0e-02
ovarian cancer -2.500 2.1e-20

Gene RIF (20)

PMID Text
26427440 Data show that both serine/threonine phosphatases PHLPP and dephosphorylated the physiological substrates of Akt1 and Akt3 with similar efficiencies.
26276160 Suggest that direct PHLPP2 downregulation is required for miR-32-induced cell proliferation of breast cancer cells.
26245343 Results showed that PHLPP1 and PHLPP2 gene expression are down-regulated in esophageal squamous cell carcinoma. Their promotor is a target for mir-224.
25977341 Our studies not only first time identify PHLPP2 downregulation by lung carcinogen B[a]P/B[a]PDE, but also elucidate a novel molecular mechanisms underlying lung inflammation and carcinogenesis upon B[a]P/B[a]PDE exposure.
25888950 miR-135a promotes cell proliferation in bladder cancer by targeting PHLPP2 and FOXO1, and is performed as an onco-
25793736 Aberrant expression of PHLPP1 and PHLPP2 correlates with poor prognosis in patients with hypopharyngeal squamous cell carcinoma
25160587 Data show that miR-372 modulated the expression of phosphoprotein phosphatase PHLPP2 by directly targeting its 3'-untranslated region (3'-UTR) and that miR-372 expression was inversely correlated with PHLPP2 expression in glioma samples.
24945731 miR-141 and its targets PHLPP1 and PHLPP2 play critical roles in NSCLC tumorigenesis
24892992 biochemical characterization of phosphatase domain of PHLPP1 and PHLPP2;PHLPP1 and PHLPP2 have similar in vitro activities and respond comparably to the presence of metallic ions; metallic ions affect structural stability of the domain;identified 3 residues likely involved in metal coordination and 2 that may be important for structural integrity
24553260 Results reveal PHLPP2 as a new biomarker of cancer progression, and implicate it as major negative regulator of NF-kappaB signaling.
23856247 Low PHLPP2 expression is associated with malignant phenotypes in non-small cell lung cancer.
23846336 This study reveals functional and mechanistic links between miRNA-224 and the tumor suppressors PHLPP1 and PHLPP2 in the pathogenesis of colorectal cancer
23715723 IGF-1 may exert its proliferative effects by negatively regulating the PTEN/PHLPP2 signaling pathway in CM cells.
23184957 Diacylglycerol signaling limits Akt activation through diacylglycerol kinase delta and PHLPP2.
22183406 PHLPP1 and PHLPP2 have an effect on retinal rod CNG channel sensitivity.
21986499 Knockdown of PHLPP1 or PHLPP2 resulted in an increase in S6K1 phosphorylation.
20513427 The PHLPP2 dephosphorylate Mst1 on the T387 inhibitory site, which activate Mst1 and its downstream effectors p38 and JNK to induce apoptosis.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19324870 A functional polymorphism that impairs the activity of PHLPP2 and correlates with elevated Akt phosphorylation and increased PKC levels, was identified.
19261608 Bcr-Abl represses the expression of PHLPP1 and PHLPP2 and continuously activates Akt1, -2, and -3 via phosphorylation on Ser-473, resulting in the proliferation of CML cells

AA Sequence

MKRNGSRNCLNRRSRFGSRERDWLREDVKRGCVYLYGADTTTATTTTTTSSSSSSSSSSSDLHLVLCTVE      1 - 70
TPASEICAGEGRESLYLQLHGDLVRRLEPTERPLQIVYDYLSRLGFDDPVRIQEEATNPDLGCMIRFYGE     71 - 140
KPCHMDRLDRILLSGIYNVRKGKTQLHKWAERLVVLCGTCLIVSSVKDCQTGKMHILPLVGGKIEEVKRR    141 - 210
QYSLAFSSAGAQAQTYHVSFETLAEYQRWQRQASKVVSQRISTVDLSCYSLEEVPEHLFYSQDITYLNLR    211 - 280
HNFMQLERPGGLDTLYKFSQLKGLNLSHNKLGLFPILLCEISTLTELNLSCNGFHDLPSQIGNLLNLQTL    281 - 350
CLDGNFLTTLPEELGNLQQLSSLGISFNNFSQIPEVYEKLTMLDRVVMAGNCLEVLNLGVLNRMNHIKHV    351 - 420
DLRMNHLKTMVIENLEGNKHITHVDLRDNRLTDLDLSSLCSLEQLHCGRNQLRELTLSGFSLRTLYASSN    421 - 490
RLTAVNVYPVPSLLTFLDLSRNLLECVPDWACEAKKIEVLDVSYNLLTEVPVRILSSLSLRKLMLGHNHV    491 - 560
QNLPTLVEHIPLEVLDLQHNALTRLPDTLFSKALNLRYLNASANSLESLPSACTGEESLSMLQLLYLTNN    561 - 630
LLTDQCIPVLVGHLHLRILHLANNQLQTFPASKLNKLEQLEELNLSGNKLKTIPTTIANCKRLHTLVAHS    631 - 700
NNISIFPEILQLPQIQFVDLSCNDLTEILIPEALPATLQDLDLTGNTNLVLEHKTLDIFSHITTLKIDQK    701 - 770
PLPTTDSTVTSTFWSHGLAEMAGQRNKLCVSALAMDSFAEGVGAVYGMFDGDRNEELPRLLQCTMADVLL    771 - 840
EEVQQSTNDTVFMANTFLVSHRKLGMAGQKLGSSALLCYIRPDTADPASSFSLTVANVGTCQAVLCRGGK    841 - 910
PVPLSKVFSLEQDPEEAQRVKDQKAIITEDNKVNGVTCCTRMLGCTYLYPWILPKPHISSTPLTIQDELL    911 - 980
ILGNKALWEHLSYTEAVNAVRHVQDPLAAAKKLCTLAQSYGCQDNVGAMVVYLNIGEEGCTCEMNGLTLP    981 - 1050
GPVGFASTTTIKDAPKPATPSSSSGIASEFSSEMSTSEVSSEVGSTASDEHNAGGLDTALLPRPERRCSL   1051 - 1120
HPTPTSGLFQRQPSSATFSSNQSDNGLDSDDDQPVEGVITNGSKVEVEVDIHCCRGRDLENSPPLIESSP   1121 - 1190
TLCSEEHARGSCFGIRRQNSVNSGMLLPMSKDRMELQKSPSTSCLYGKKLSNGSIVPLEDSLNLIEVATE   1191 - 1260
VPKRKTGYFAAPTQMEPEDQFVVPHDLEEEVKEQMKQHQDSRLEPEPHEEDRTEPPEEFDTAL          1261 - 1323
//

Text Mined References (40)

PMID Year Title
26427440 2016 Photoreceptor Neuroprotection: Regulation of Akt Activation Through Serine/Threonine Phosphatases, PHLPP and PHLPPL.
26276160 2015 MiR-32 contributed to cell proliferation of human breast cancer cells by suppressing of PHLPP2 expression.
26245343 2015 Expression and role of oncogenic miRNA-224 in esophageal squamous cell carcinoma.
25977341 2015 PHLPP2 Downregulation Contributes to Lung Carcinogenesis Following B[a]P/B[a]PDE Exposure.
25888950 2015 Mir-135a enhances cellular proliferation through post-transcriptionally regulating PHLPP2 and FOXO1 in human bladder cancer.
25793736 2015 Aberrant expression of PHLPP1 and PHLPP2 correlates with poor prognosis in patients with hypopharyngeal squamous cell carcinoma.
25217961 2014 A meta-analysis of 87,040 individuals identifies 23 new susceptibility loci for prostate cancer.
25160587 2015 miR-372 regulates glioma cell proliferation and invasion by directly targeting PHLPP2.
24945731 2014 MicroRNA-141 promotes the proliferation of non-small cell lung cancer cells by regulating expression of PHLPP1 and PHLPP2.
24892992 2014 Biochemical characterization of the phosphatase domain of the tumor suppressor PH domain leucine-rich repeat protein phosphatase.
24553260 2014 PHLPP2 suppresses the NF-?B pathway by inactivating IKK? kinase.
24530606 2014 PHLPP is a negative regulator of RAF1, which reduces colorectal cancer cell motility and prevents tumor progression in mice.
23856247 2013 miR-205 targets PTEN and PHLPP2 to augment AKT signaling and drive malignant phenotypes in non-small cell lung cancer.
23846336 2013 microRNA-224 promotes cell proliferation and tumor growth in human colorectal cancer by repressing PHLPP1 and PHLPP2.
23715723 2013 Inhibitory effect of atorvastatin on the cell growth of cardiac myxomas via the PTEN and PHLPP2 phosphatase signaling pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23184957 2013 Diacylglycerol kinase ? modulates Akt phosphorylation through pleckstrin homology domain leucine-rich repeat protein phosphatase 2 (PHLPP2).
22183406 2012 Ras-associating domain proteins: a new class of cyclic nucleotide-gated channel modulators.
21986499 2011 PHLPP-mediated dephosphorylation of S6K1 inhibits protein translation and cell growth.
21804599 2012 PTEN, NHERF1 and PHLPP form a tumor suppressor network that is disabled in glioblastoma.
20513427 2010 Mst1 is an interacting protein that mediates PHLPPs' induced apoptosis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19732725 2009 FKBP51 affects cancer cell response to chemotherapy by negatively regulating Akt.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19324870 2009 Common polymorphism in the phosphatase PHLPP2 results in reduced regulation of Akt and protein kinase C.
19261608 2009 Depletion of Pleckstrin homology domain leucine-rich repeat protein phosphatases 1 and 2 by Bcr-Abl promotes chronic myelogenous leukemia cell proliferation through continuous phosphorylation of Akt isoforms.
19079341 2009 Loss of PHLPP expression in colon cancer: role in proliferation and tumorigenesis.
18162466 2008 The phosphatase PHLPP controls the cellular levels of protein kinase C.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17386267 2007 PHLPP and a second isoform, PHLPP2, differentially attenuate the amplitude of Akt signaling by regulating distinct Akt isoforms.
16381901 2006 The LIFEdb database in 2006.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.