Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.44
PubTator Score 7.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
malignant mesothelioma 3163 3.8e-08
invasive ductal carcinoma 2950 1.4e-02
osteosarcoma 7933 2.6e-02

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -2.600 3.8e-08
osteosarcoma 1.240 2.6e-02
invasive ductal carcinoma -1.200 1.4e-02

Synonym

Accession Q9Y5J5 B2R5A4 Q53HD6 Q8NBW9
Symbols TIH1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

PMID Text
25667479 Low PHLDA3 expression in ESCC may be predictive of tumor recurrence suggesting that Akt activation may be a therapeutic target in ESCCs
24912192 Results indicate that tumor suppressor PHLDA3-mediated pathway is important in the development of pancreatic neuroendocrine tumors (PanNETs).
21753719 findings indicate somatic mutation of PHLDA3 is rare in common cancer types; PHLDA3 expression was lost in 22% of prostate cancers; these results indicate that PHLDA3 are altered in prostate cancers by loss of expression
19203586 Study identifies PHLDA3 as a p53 target gene that encodes a PH domain-only protein and finds that PHLDA3 competes with the PH domain of Akt for binding of membrane lipids, inhibiting Akt translocation to the cellular membrane and activation.

AA Sequence

MTAAATATVLKEGVLEKRSGGLLQLWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIKAVECVESTGRH      1 - 70
IYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSLGTGTLVS                  71 - 127
//

Text Mined References (17)

PMID Year Title
25667479 2015 Low PHLDA3 expression in oesophageal squamous cell carcinomas is associated with poor prognosis.
24912192 2014 PHLDA3 is a novel tumor suppressor of pancreatic neuroendocrine tumors.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21753719 2011 Expressional and mutational analysis of PHLDA3 gene in common human cancers.
21269460 2011 Initial characterization of the human central proteome.
19203586 2009 PH domain-only protein PHLDA3 is a p53-regulated repressor of Akt.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15940259 2005 A p53-dominant transcriptional response to cisplatin in testicular germ cell tumor-derived human embryonal carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10594239 1999 A novel pleckstrin homology-related gene family defined by Ipl/Tssc3, TDAG51, and Tih1: tissue-specific expression, chromosomal location, and parental imprinting.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.