Property Summary

NCBI Gene PubMed Count 38
PubMed Score 57.41
PubTator Score 65.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
osteosarcoma 2.441 2.0e-03
astrocytic glioma -1.500 1.9e-02
Breast cancer 1.100 3.3e-02
breast carcinoma 1.600 9.8e-04
ductal carcinoma in situ 2.500 4.7e-04
ependymoma -1.500 3.9e-02
gastric cancer -1.400 3.9e-02
glioblastoma 1.200 4.1e-02
group 4 medulloblastoma -2.000 2.0e-03
hepatocellular carcinoma -1.800 8.9e-04
intraductal papillary-mucinous neoplasm ... 2.600 1.5e-02
lung adenocarcinoma 1.900 7.6e-11
lung cancer 1.300 6.4e-04
medulloblastoma, large-cell -1.400 1.8e-02
nephrosclerosis 1.287 2.2e-03
non primary Sjogren syndrome sicca -1.100 2.2e-02
oligodendroglioma -1.700 1.3e-02
ovarian cancer 3.900 1.3e-05
pancreatic cancer 2.800 4.1e-07
pancreatic ductal adenocarcinoma liver m... 2.202 1.3e-02
pediatric high grade glioma 1.900 1.3e-02
pituitary cancer -1.900 4.1e-05
psoriasis 1.100 5.5e-04
Rheumatoid arthritis 1.200 5.0e-02
spina bifida -1.568 4.5e-02
tuberculosis -1.600 4.8e-02
ulcerative colitis 1.800 9.5e-07

Gene RIF (22)

AA Sequence

MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYF      1 - 70
TIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEP     71 - 140
SRPSPQPKPRTP                                                              141 - 152
//

Text Mined References (47)

PMID Year Title