Property Summary

NCBI Gene PubMed Count 35
PubMed Score 55.82
PubTator Score 65.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
osteosarcoma 2.441 2.0e-03
Rheumatoid Arthritis 1.200 5.0e-02
nephrosclerosis 1.287 2.2e-03
gastric carcinoma 2.800 3.5e-02
hepatocellular carcinoma -1.800 8.9e-04
astrocytic glioma -1.500 1.9e-02
ependymoma -1.500 3.9e-02
oligodendroglioma -1.700 1.3e-02
psoriasis 3.300 8.1e-05
glioblastoma 1.200 4.1e-02
medulloblastoma, large-cell -1.400 1.8e-02
tuberculosis -1.600 4.8e-02
pancreatic ductal adenocarcinoma liver m... 2.202 1.3e-02
intraductal papillary-mucinous neoplasm ... 2.600 1.5e-02
lung cancer 1.300 6.4e-04
pancreatic cancer 2.800 4.1e-07
breast carcinoma 1.600 9.8e-04
pediatric high grade glioma 1.900 1.3e-02
group 4 medulloblastoma -2.000 2.0e-03
non primary Sjogren syndrome sicca -1.100 2.2e-02
lung adenocarcinoma 2.381 8.9e-07
Breast cancer 1.100 3.3e-02
spina bifida -1.568 4.5e-02
ductal carcinoma in situ 2.500 4.7e-04
ulcerative colitis 1.800 9.5e-07
ovarian cancer 3.900 1.3e-05
pituitary cancer -1.900 4.1e-05

Synonym

Accession Q53GA4 O00496
Symbols IPL
BRW1C
BWR1C
HLDA2
TSSC3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (19)

PMID Text
26944942 Placental PHLDA2 expression was significantly 2.3 fold higher in reduced fetal movements pregnancies resulting in delivery of a growth restricted compared with a normal birth weight infant.
26845447 TSSC3 downregulation promotes the Epithelial to mesenchymal transition (EMT) of osteosarcoma cells by regulating EMT markers via a signal transduction pathway that involves Snail, Wnt-beta-catenin/TCF, and GSK-3beta
26218012 PHLDA2 may promote the occurrence/development of preeclampsia by inhibiting proliferation/migration/invasion of trophoblasts.
24986528 The gene expression pattern of CDKN1C, H19, IGF2, KCNQ1 and PHLDA2 genes was evaluated using RT-PCR.
24953163 elevated expression in placenta of growth restricted pregnancies [review]
24703004 results suggest upregulated pleckstrin homology-like domain family A member 2 (PHLDA2) in placenta of monozygotic twins may be associated with the pathogenesis of singleton intrauterine growth restriction
24268429 TSSC3 overexpression suppressed osteosarcoma cell growth and increased apoptosis through caspase-3 upregulation, suggesting that TSSC3 may play a pro-apoptosis role to maintain the normal balance of growth
22610481 TSSC3 inhibits osteosarcoma tumorigenicity through reducing stemness and promoting apoptosis of tumor inducing cells
22444668 A luciferase reporter assay was used to identify in the PHLDA2 promoter a 15 bp repeat sequence variant that significantly reduces PHLDA2-promoter efficiency. Maternal inheritance of the variant resulted in a significant increase in birth weight.
22100507 The results suggest that placental PHLDA2 may provide a biomarker for suboptimal skeletal growth in pregnancies uncomplicated by overt fetal growth restriction.
22021909 TSSC3 has a potent tumor suppressor role in osteosarcoma, probably by inhibition of growth and induction of apoptosis via the mitochondrial apoptosis pathway.
21555518 PHLDA2 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
20484977 Expression levels of PHLDA2 gene were upregulated in the first trimester pregnancy
20201924 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17303335 Up-regulation of TSSC3 occurred in Dicer knockdown cells.
17180344 association with low birth weight
16584773 Exposure of trophoblasts to hypoxia in vitro markedly reduced the expression of PHLDA2.
15952111 Transcripts of TSSC3 could not be detected in human oocytes and preimplantation embryos.
9328465 PHLDA2 gene is imprinted, with preferential expression from the maternal allele in placenta and liver.

AA Sequence

MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYF      1 - 70
TIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEP     71 - 140
SRPSPQPKPRTP                                                              141 - 152
//

Text Mined References (44)

PMID Year Title
26944942 2016 Placental PHLDA2 expression is increased in cases of fetal growth restriction following reduced fetal movements.
26845447 2016 Downregulation of tumor suppressing STF cDNA 3 promotes epithelial-mesenchymal transition and tumor metastasis of osteosarcoma by the Wnt/GSK-3?/?-catenin/Snail signaling pathway.
26218012 2015 The expression of the imprinted gene pleckstrin homology-like domain family A member 2 in placental tissues of preeclampsia and its effects on the proliferation, migration and invasion of trophoblast cells JEG-3.
24986528 2014 Relevance of genomic imprinting in intrauterine human growth expression of CDKN1C, H19, IGF2, KCNQ1 and PHLDA2 imprinted genes.
24953163 2014 The significance of elevated placental PHLDA2 in human growth restricted pregnancies.
24703004 2014 Placental expression of PHLDA2 in selective intrauterine growth restriction in monozygotic twins.
24268429 2014 Epigenetic regulation of the pro-apoptosis gene TSSC3 in human osteosarcoma cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22610481 2012 TSSC3 overexpression reduces stemness and induces apoptosis of osteosarcoma tumor-initiating cells.
22444668 2012 Maternal inheritance of a promoter variant in the imprinted PHLDA2 gene significantly increases birth weight.
22100507 2012 Relationship between placental expression of the imprinted PHLDA2 gene, intrauterine skeletal growth and childhood bone mass.
22021909 2012 TSSC3 overexpression associates with growth inhibition, apoptosis induction and enhances chemotherapeutic effects in human osteosarcoma.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
20705733 2010 Common variants in the calcium-sensing receptor gene are associated with total serum calcium levels.
20484977 2010 Gene expression pattern of IGF2, PHLDA2, PEG10 and CDKN1C imprinted genes in spontaneous miscarriages or fetal deaths.
20201924 2010 Genome-wide association study of alcohol dependence implicates a region on chromosome 11.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19203586 2009 PH domain-only protein PHLDA3 is a p53-regulated repressor of Akt.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17388661 2007 Exquisite sensitivity of TP53 mutant and basal breast cancers to a dose-dense epirubicin-cyclophosphamide regimen.
17303335 2007 Upregulation of PHLDA2 in Dicer knockdown HEK293 cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17180344 2007 Elevated placental expression of the imprinted PHLDA2 gene is associated with low birth weight.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16584773 Hypoxia regulates the expression of PHLDA2 in primary term human trophoblasts.
15952111 2005 Expression of imprinted genes related to Beckwith-Wiedemann syndrome in human oocytes and preimplantation embryos.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15457853 2004 Immunohistochemistry for the imprinted gene product IPL/PHLDA2 for facilitating the differential diagnosis of complete hydatidiform mole.
15314611 2004 Complete hydatidiform mole retaining a chromosome 11 of maternal origin: molecular genetic analysis of a case.
13129680 The product of the imprinted gene IPL marks human villous cytotrophoblast and is lost in complete hydatidiform mole.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12374806 2002 Phosphoinositide binding by the pleckstrin homology domains of Ipl and Tih1.
12032310 2002 Placental overgrowth in mice lacking the imprinted gene Ipl.
10749982 2000 Retention of imprinting of the human apoptosis-related gene TSSC3 in human brain tumors.
10594239 1999 A novel pleckstrin homology-related gene family defined by Ipl/Tssc3, TDAG51, and Tih1: tissue-specific expression, chromosomal location, and parental imprinting.
10197590 1999 Imprinting of a genomic domain of 11p15 and loss of imprinting in cancer: an introduction.
9520460 1998 Transcriptional map of 170-kb region at chromosome 11p15.5: identification and mutational analysis of the BWR1A gene reveals the presence of mutations in tumor samples.
9500470 1998 Genomic imprinting of a human apoptosis gene homologue, TSSC3.
9403053 1997 A 2.5-Mb transcript map of a tumor-suppressing subchromosomal transferable fragment from 11p15.5, and isolation and sequence analysis of three novel genes.
9328465 1997 The IPL gene on chromosome 11p15.5 is imprinted in humans and mice and is similar to TDAG51, implicated in Fas expression and apoptosis.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.