Property Summary

NCBI Gene PubMed Count 27
PubMed Score 49.25
PubTator Score 41.88

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Synonym

Accession Q8WV24 A1A4G9 Q15184 Q2TAN2 Q9NZ17
Symbols PHRIP
TDAG51
DT1P1B11

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (17)

PMID Text
26191222 Suggest decreased expression of PHLDA1 may play an important role in tumor progression, and may become a new adjunct biomarker in the prognosis in gastric adenocarcinoma.
24954507 Data suggest that high PHLDA1 expression is controlled through an ER-NFkappaB-miR-181 regulatory axis and may contribute to a poor clinical outcome in patients with ER+ breast tumors by enhancing stem-like properties in these tumors.
24270013 A role for PHLDA1 as an apoptosis suppressor in oral cancer cells.
23962557 Data show that downregulation of aurora A kinase by the therapeutic antibody is associated with decreased levels of MYCN protein in cytoplasm, and induced expression of PHLDA1 and P53 proteins.
23719479 PHLDA1 expression is a useful addition in differentiating trichoblastoma and basal cell carcinoma.
23489134 The follicular stem cell marker PHLDA1 (TDAG51) indicates that most basaloid tumors in nevus sebaceus are basal cell carcinomas and not trichoblastomas.
23398472 PHLDA1 differentiates between desmoplastic trichoepithelioma and morpheaform basal cell carcinoma but shows variable staining in microcystic adnexal carcinoma.
22592641 the release of Ca(2+) from endoplasmic reticulum stores mediates epithelial-to-mesenchymal transition in human proximal tubular epithelium via the induction of TDAG51
21807936 crucial negative regulator and effector of Aurora A kinase in breast cancer
21558389 PHLDA1 expression marks the putative epithelial stem cells, downregulates ITGA2 and ITGA6, and contributes to intestinal tumorigenesis
18641796 The anti-estrogen ICI 182,780 (1 microM) inhibited PHLDA1 mRNA expression and completely abolished the effect of 10 nM 17beta-estradiol on PHLDA1 expression (P < 0.05), suggesting that PHLDA1 is regulated by estrogen via ER.
17870236 TDAG51 in patients with intractable epilepsy was significantly higher when compared with levels in the controls.
17211533 Reduced PHLDA1 expression is important in breast cancer progression and could serve as useful prognostic marker of disease outcome.
15315823 TDAG51 locus shows an operon-like organization of two head-to-head oriented transcripts that are inversely regulated in T lymphocytes by a CpG-rich bidirectional promoter.
15037619 TDAG51 plays an important role in the anti-apoptotic effects of IGF-I.
15002043 expression of TDAG51 in human T-cells does not correlate with activation-induced cell death
12384558 The progressive loss of PHLDA1 expression in melanomas may play a role in deregulated cell growth and apoptosis resistance in these tumors.

AA Sequence

MRRAPAAERLLELGFPPRCGRQEPPFPLGVTRGWGRWPIQKRREGARPVPFSERSQEDGRGPAARSSGTL      1 - 70
WRIRTRLSLCRDPEPPPPLCLLRVSLLCALRAGGRGSRWGEDGARLLLLPPARAAGNGEAEPSGGPSYAG     71 - 140
RMLESSGCKALKEGVLEKRSDGLLQLWKKKCCILTEEGLLLIPPKQLQHQQQQQQQQQQQQQQQPGQGPA    141 - 210
EPSQPSGPAVASLEPPVKLKELHFSNMKTVDCVERKGKYMYFTVVMAEGKEIDFRCPQDQGWNAEITLQM    211 - 280
VQYKNRQAILAVKSTRQKQQHLVQQQPPSQPQPQPQLQPQPQPQPQPQPQPQSQPQPQPQPKPQPQQLHP    281 - 350
YPHPHPHPHSHPHSHPHPHPHPHPHQIPHPHPQPHSQPHGHRLLRSTSNSA                       351 - 401
//

Text Mined References (28)

PMID Year Title
26191222 2015 Correlation of decreased expression of PHLDA1 protein with malignant phenotype of gastric adenocarcinoma.
24954507 2015 PHLDA1 expression is controlled by an estrogen receptor-NF?B-miR-181 regulatory loop and is essential for formation of ER+ mammospheres.
24270013 2014 Differential susceptibility to hydrogen sulfide-induced apoptosis between PHLDA1-overexpressing oral cancer cell lines and oral keratinocytes: role of PHLDA1 as an apoptosis suppressor.
23962557 2013 Targeting GD2 ganglioside and aurora A kinase as a dual strategy leading to cell death in cultures of human neuroblastoma cells.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
23719479 2014 PHLDA1, a follicular stem cell marker, differentiates clear-cell/granular-cell trichoblastoma and clear-cell/granular cell basal cell carcinoma: a case-control study, with first description of granular-cell trichoblastoma.
23489134 2013 Basaloid tumors in nevus sebaceus revisited: the follicular stem cell marker PHLDA1 (TDAG51) indicates that most are basal cell carcinomas and not trichoblastomas.
23398472 2013 The immunohistochemical differential diagnosis of microcystic adnexal carcinoma, desmoplastic trichoepithelioma and morpheaform basal cell carcinoma using BerEP4 and stem cell markers.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22592641 2012 TDAG51 mediates epithelial-to-mesenchymal transition in human proximal tubular epithelium.
21807936 2011 PHLDA1 is a crucial negative regulator and effector of Aurora A kinase in breast cancer.
21558389 2011 PHLDA1 expression marks the putative epithelial stem cells and contributes to intestinal tumorigenesis.
19060904 2009 An empirical framework for binary interactome mapping.
18641796 2008 Transcriptional up-regulation of PHLDA1 by 17beta-estradiol in MCF-7 breast cancer cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17870236 2007 TDAG51 in the anterior temporal neocortex of patients with intractable epilepsy.
17211533 2007 Down-regulation of PHLDA1 gene expression is associated with breast cancer progression.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15315823 2004 A CpG-rich bidirectional promoter induces the T-cell death-associated gene 51 and downregulates an inversely oriented transcript during early T-cell activation.
15037619 2004 TDAG51 mediates the effects of insulin-like growth factor I (IGF-I) on cell survival.
15002043 2004 Regulation of T-cell death-associated gene 51 (TDAG51) expression in human T-cells.
12738777 2003 TDAG51 is induced by homocysteine, promotes detachment-mediated programmed cell death, and contributes to the cevelopment of atherosclerosis in hyperhomocysteinemia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12384558 2002 Identification of the human PHLDA1/TDAG51 gene: down-regulation in metastatic melanoma contributes to apoptosis resistance and growth deregulation.
11369516 2001 Inhibition of protein synthesis by the T cell receptor-inducible human TDAG51 gene product.
10894922 2000 Assignment of the human PHLDA1 gene to chromosome 12q15 by radiation hybrid mapping.
9417904 1997 Mapping and characterization of novel (CAG)n repeat cDNAs from adult human brain derived by the oligo capture method.