Property Summary

NCBI Gene PubMed Count 24
PubMed Score 8.59
PubTator Score 5.79

Knowledge Summary

Patent (604)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 2.100 1.6e-03
ependymoma 1.500 3.1e-02
oligodendroglioma 1.500 4.4e-03
osteosarcoma 1.348 2.2e-04
Duchenne muscular dystrophy -1.119 8.3e-06
autosomal dominant Emery-Dreifuss muscul... -1.124 4.3e-03
dermatomyositis -2.000 1.0e-03

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

AA Sequence

MTRDEALPDSHSAQDFYENYEPKEILGRGVSSVVRRCIHKPTSQEYAVKVIDVTGGGSFSPEEVRELREA      1 - 70
TLKEVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKVTLSEKETRKIMRALLEVICT     71 - 140
LHKLNIVHRDLKPENILLDDNMNIKLTDFGFSCQLEPGERLREVCGTPSYLAPEIIECSMNEDHPGYGKE    141 - 210
VDMWSTGVIMYTLLAGSPPFWHRKQMLMLRMIMSGNYQFGSPEWDDYSDTVKDLVSRFLVVQPQNRYTAE    211 - 280
EALAHPFFQQYLVEEVRHFSPRGKFKVIALTVLASVRIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAY    281 - 350
AFRIYGHWVKKGQQQNRAALFENTPKAVLLSLAEEDY                                     351 - 387
//

Text Mined References (26)

PMID Year Title
17692548 2007 In Silico characterization of phosphorylase kinase: evidence for an alternate intronic polyadenylation site in PHKG1.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12825073 2003 Muscle glycogenosis with low phosphorylase kinase activity: mutations in PHKA1, PHKG1 or six other candidate genes explain only a minority of cases.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12387894 2002 Involvement of aberrant glycosylation in phosphorylation of tau by cdk5 and GSK-3beta.
10737616 2000 Phosphorylation sites on tau identified by nanoelectrospray mass spectrometry: differences in vitro between the mitogen-activated protein kinases ERK2, c-Jun N-terminal kinase and P38, and glycogen synthase kinase-3beta.
10090741 1999 Phosphorylation that detaches tau protein from microtubules (Ser262, Ser214) also protects it against aggregation into Alzheimer paired helical filaments.
9832145 1998 New phosphorylation sites identified in hyperphosphorylated tau (paired helical filament-tau) from Alzheimer's disease brain using nanoelectrospray mass spectrometry.
9771888 1998 Tau is phosphorylated by GSK-3 at several sites found in Alzheimer disease and its biological activity markedly inhibited only after it is prephosphorylated by A-kinase.
9735171 1998 Phosphorylation of tau at both Thr 231 and Ser 262 is required for maximal inhibition of its binding to microtubules.
9362479 1997 The crystal structure of a phosphorylase kinase peptide substrate complex: kinase substrate recognition.
8999860 1997 The regulatory Ser262 of microtubule-associated protein tau is phosphorylated by phosphorylase kinase.
8672716 1996 A comparison of the properties of the binary and ternary complexes formed by calmodulin and troponin C with two regulatory peptides of phosphorylase kinase.
8530014 1995 Human cDNA encoding the muscle isoform of the phosphorylase kinase gamma subunit (PHKG1).
7935360 1993 Preparation and functional characterization of a catalytically active fragment of phosphorylase kinase.
7929096 1994 Oxidation and site-directed mutagenesis of the sulfhydryl groups of a truncated gamma catalytic subunit of phosphorylase kinase. Functional and structural effects.
7874115 1994 Human muscle glycogenosis due to phosphorylase kinase deficiency associated with a nonsense mutation in the muscle isoform of the alpha subunit.
7706316 1995 Microtubule-associated protein/microtubule affinity-regulating kinase (p110mark). A novel protein kinase that regulates tau-microtubule interactions and dynamic instability by phosphorylation at the Alzheimer-specific site serine 262.
2507540 1989 The gamma-subunit of skeletal muscle phosphorylase kinase contains two noncontiguous domains that act in concert to bind calmodulin.
2365696 1990 Purification and characterization of catalytic fragments of phosphorylase kinase gamma subunit missing a calmodulin-binding domain.
2297530 1990 Localisation of the gene encoding the catalytic gamma subunit of phosphorylase kinase to human chromosome bands 7p12-q21.