Property Summary

NCBI Gene PubMed Count 37
PubMed Score 1317.39
PubTator Score 334.00

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (1)

Gene RIF (19)

PMID Text
26439504 High expression of PHGDH is associated with Colon Cancer.
26026368 Overexpression of Phgdh may be generally associated with CK5 cells, and oncogenic function may be determined by isoform expression.
25404730 p53-mediated repression of PHGDH enhances the apoptotic response upon serine starvation in melanoma cells.
25152457 Phosphoglycerate Dehydrogenase deficiency is associated with Neu-Laxova syndrome.
24836451 We report on the identification of homozygous mutations in PHGDH and serine deficiency in individuals with Neu-Laxova syndrome. This disorder thus seems to be an extremely severe expression of PHGDH deficiency.
24247658 PHGDH overexpression is found in cervical cancer, in particular, in bigger tumors and with advanced stages. Its expression is positively correlated with squamous cell carcinoma antigen level
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
21981974 The potential mechanisms by which PHGDH promotes cancer are discussed.
21804546 in some cancer cells a relatively large amount of glycolytic carbon is diverted into serine and glycine metabolism through phosphoglycerate dehydrogenase.
21760589 results reveal that certain breast cancers are dependent upon increased serine pathway flux caused by PHGDH overexpression and demonstrate the utility of in vivo negative-selection RNAi screens for finding potential anticancer targets
19778996 PHGDH is expressed in cytoplasm of stromal and glandular cells in endometrium; expression is relatively high in proliferative phase and lower in secretory phase. Data suggest expression of PHGDH in endometrium is regulated by HOXA10.
19497206 The frequency of antibodies to Phgdh is much higher in patients with autoimmune hepatitis than in patients with other types of hepatitis or normal controls.
19404161 a coding PHGDH SNP (rs543703) was weakly associated with the development of schizophrenia in Korean population
19388702 Studies in bacteria showed that addition of substrate at the active site is ordered, with HPAP binding before NADH. Also, NADH can compete with the substrate for binding to the allosteric site and thereby eliminate the substrate inhibition.
19235232 These data suggest that missense mutations associated with 3-PGDH deficiency either primarily affect substrate binding or result in very low residual enzymatic activity.
19223009 Observational study of gene-disease association. (HuGE Navigator)
18627175 The crystal structure of Mycobacterium tuberculosis D-3-phosphoglycerate dehydrogenase has been solved with bound effector, 1-serine, and substrate, hydroxypyruvic acid phosphate. The human enzyme was also examined.
17676665 HIV-1 gp120 upregulates the expression of PHGDH in umbilical cord blood mononuclear cells and T-cell lines
11751922 we conclude that this mutation impairs the folding and/or assembly of PHGDH but has minimal effects on the activity or stability of that portion of the V490M mutant that reaches a mature conformation

AA Sequence

MAFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKL      1 - 70
QVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMG     71 - 140
TELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLL    141 - 210
PSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVIS    211 - 280
CPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSP    281 - 350
KGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGE    351 - 420
CLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGV    421 - 490
RLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF                               491 - 533
//

Text Mined References (46)

PMID Year Title
26439504 2015 Clinical Implication of Serine Metabolism-Associated Enzymes in Colon Cancer.
26026368 2015 High level PHGDH expression in breast is predominantly associated with keratin 5-positive cell lineage independently of malignancy.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25404730 2015 p53 Protein-mediated regulation of phosphoglycerate dehydrogenase (PHGDH) is crucial for the apoptotic response upon serine starvation.
25152457 2014 Neu-Laxova syndrome is a heterogeneous metabolic disorder caused by defects in enzymes of the L-serine biosynthesis pathway.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24836451 2014 Neu-Laxova syndrome, an inborn error of serine metabolism, is caused by mutations in PHGDH.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24247658 2013 Expression and clinical significance of phosphoglycerate dehydrogenase and squamous cell carcinoma antigen in cervical cancer.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23378610 2013 Genetic variants associated with glycine metabolism and their role in insulin sensitivity and type 2 diabetes.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
21981974 2011 PHGDH amplification and altered glucose metabolism in human melanoma.
21886157 2011 Human metabolic individuality in biomedical and pharmaceutical research.
21804546 2011 Phosphoglycerate dehydrogenase diverts glycolytic flux and contributes to oncogenesis.
21760589 2011 Functional genomics reveal that the serine synthesis pathway is essential in breast cancer.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19778996 2010 3-Phosphoglycerate dehydrogenase expression is regulated by HOXA10 in murine endometrium and human endometrial cells.
19497206 2009 [Cloning and expression of 3-phosphoglycerate dehydrogenase gene and its correlative antibodies in diagnosis of autoimmune hepatitis].
19404161 2009 Assessment between phosphoglycerate dehydrogenase gene and schizophrenia in Korean population.
19388702 2009 Role of the anion-binding site in catalysis and regulation of Mycobacterium tuberculosis D-3-phosphoglycerate dehydrogenase.
19235232 2009 Novel mutations in 3-phosphoglycerate dehydrogenase (PHGDH) are distributed throughout the protein and result in altered enzyme kinetics.
19223009 2009 Association analysis of glycine- and serine-related genes in a Japanese population of patients with schizophrenia.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18627175 2008 Structural analysis of substrate and effector binding in Mycobacterium tuberculosis D-3-phosphoglycerate dehydrogenase.
18378410 2008 Positive regulation of promoter activity of human 3-phosphoglycerate dehydrogenase (PHGDH) gene is mediated by transcription factors Sp1 and NF-Y.
16949628 2006 Identification of novel proteins induced by estradiol, 4-hydroxytamoxifen and acolbifene in T47D breast cancer cells.
16730941 2006 A systematic analysis of human CHMP protein interactions: additional MIT domain-containing proteins bind to multiple components of the human ESCRT III complex.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11751922 2002 V490M, a common mutation in 3-phosphoglycerate dehydrogenase deficiency, causes enzyme deficiency by decreasing the yield of mature enzyme.
11055895 2000 Molecular characterization of 3-phosphoglycerate dehydrogenase deficiency--a neurometabolic disorder associated with reduced L-serine biosynthesis.
11034457 2000 3-phosphoglycerate dehydrogenase deficiency in a patient with West syndrome.
10894924 2000 Assignment of human 3-phosphoglycerate dehydrogenase (PHGDH) to human chromosome band 1p12 by fluorescence in situ hybridization.
10713460 2000 Nucleotide sequence and differential expression of the human 3-phosphoglycerate dehydrogenase gene.
8758134 1996 3-Phosphoglycerate dehydrogenase deficiency: an inborn error of serine biosynthesis.