Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.25
PubTator Score 2.33

Knowledge Summary


No data available


  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.200 1.0e-02
ependymoma 1.300 3.2e-02
oligodendroglioma 1.300 1.4e-02
sonic hedgehog group medulloblastoma 3.500 1.7e-10
medulloblastoma, large-cell 3.000 3.3e-05
primitive neuroectodermal tumor 2.000 1.2e-03
psoriasis -1.300 7.2e-06

Gene RIF (2)

25454821 These data suggest that PHF21B is a novel tumor suppressor gene that can be inactivated by genetic and epigenetic mechanisms in the human cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

GEQLLQVTMTTTSPAPLLAGPWTKPSVAATHPTVQHPQGHN                                 491 - 531

Text Mined References (9)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25454821 2015 PHF21B as a candidate tumor suppressor gene in head and neck squamous cell carcinomas.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.