Property Summary

NCBI Gene PubMed Count 17
PubMed Score 54.14
PubTator Score 62.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
glioblastoma 1.500 2.0e-04
osteosarcoma -1.671 8.4e-03
medulloblastoma 1.200 1.5e-02
non-small cell lung cancer 1.181 3.2e-13
intraductal papillary-mucinous neoplasm ... 2.000 2.4e-03
pediatric high grade glioma 1.300 9.3e-06
lung adenocarcinoma 1.900 5.8e-12
psoriasis 1.200 5.5e-13
inflammatory breast cancer 1.400 6.6e-03
ulcerative colitis 1.200 8.3e-05

Gene RIF (6)

PMID Text
25955388 These results provide evidence that PHF19 promotes Hepatocellular carcinoma and is regulated by the tumor-suppressor, miR-195-5p
23228662 The histone H3K36me3 binding by the Tudor domains of PHF1, PHF19 and likely MTF2 provide another recruitment and regulatory mechanism for the PRC2 complex
23160351 propose a model whereby PHF19 functions during mouse embryonic stem cell differentiation to transiently bind the H3K36me3 mark via its Tudor domain
22487681 PHF19 silencing reduces the cell proliferation rate and increases the transendothelial migration capacities of melanoma cell lines.
21143197 Functional characterization of human Polycomb-like 3 isoforms identifies them as components of distinct EZH2 protein complexes
15563832 identification of a gene encoding a human homologue of the Drosophila polycomblike protein, hPCL3 gene, encoding two nuclear proteins, hPCL3S and hPCL3L; markedly overexpressed in many types of cancers

AA Sequence

MENRALDPGTRDSYGATSHLPNKGALAKVKNNFKDLMSKLTEGQYVLCRWTDGLYYLGKIKRVSSSKQSC      1 - 70
LVTFEDNSKYWVLWKDIQHAGVPGEEPKCNICLGKTSGPLNEILICGKCGLGYHQQCHIPIAGSADQPLL     71 - 140
TPWFCRRCIFALAVRKGGALKKGAIARTLQAVKMVLSYQPEELEWDSPHRTNQQQCYCYCGGPGEWYLRM    141 - 210
LQCYRCRQWFHEACTQCLNEPMMFGDRFYLFFCSVCNQGPEYIERLPLRWVDVVHLALYNLGVQSKKKYF    211 - 280
DFEEILAFVNHHWELLQLGKLTSTPVTDRGPHLLNALNSYKSRFLCGKEIKKKKCIFRLRIRVPPNPPGK    281 - 350
LLPDKGLLPNENSASSELRKRGKSKPGLLPHEFQQQKRRVYRRKRSKFLLEDAIPSSDFTSAWSTNHHLA    351 - 420
SIFDFTLDEIQSLKSASSGQTFFSDVDSTDAASTSGSASTSLSYDSRWTVGSRKRKLAAKAYMPLRAKRW    421 - 490
AAELDGRCPSDSSAEGASVPERPDEGIDSHTFESISEDDSSLSHLKSSITNYFGAAGRLACGEKYQVLAR    491 - 560
RVTPEGKVQYLVEWEGTTPY                                                      561 - 580
//

Text Mined References (22)

PMID Year Title
25955388 2015 MicroRNA-195-5p acts as an anti-oncogene by targeting PHF19 in hepatocellular carcinoma.
24782177 2014 Novel risk loci for rheumatoid arthritis in Han Chinese and congruence with risk variants in Europeans.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23273982 2013 An H3K36 methylation-engaging Tudor motif of polycomb-like proteins mediates PRC2 complex targeting.
23228662 2013 Tudor domains of the PRC2 components PHF1 and PHF19 selectively bind to histone H3K36me3.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23160351 2012 Polycomb PHF19 binds H3K36me3 and recruits PRC2 and demethylase NO66 to embryonic stem cell genes during differentiation.
23104054 2012 Phf19 links methylated Lys36 of histone H3 to regulation of Polycomb activity.
22487681 2012 PHF19 and Akt control the switch between proliferative and invasive states in melanoma.
21383967 2011 Meta-analysis of genome-wide association studies in celiac disease and rheumatoid arthritis identifies fourteen non-HLA shared loci.
21143197 2011 Functional characterization of human Polycomb-like 3 isoforms identifies them as components of distinct EZH2 protein complexes.
19503088 2009 REL, encoding a member of the NF-kappaB family of transcription factors, is a newly defined risk locus for rheumatoid arthritis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15563832 2004 A novel human homologue of Drosophila polycomblike gene is up-regulated in multiple cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.