Property Summary

NCBI Gene PubMed Count 9
PubMed Score 25.06
PubTator Score 10.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.293 4.2e-05
ovarian cancer 1.600 7.4e-05
pancreatic cancer 1.100 2.2e-03
primary pancreatic ductal adenocarcinoma 1.151 6.3e-03

Gene RIF (3)

AA Sequence

MDSDSCAAAFHPEEYSPSCKRRRTVEDFNKFCTFVLAYAGYIPYPKEELPLRSSPSPANSTAGTIDSDGW      1 - 70
DAGFSDIASSVPLPVSDRCFSHLQPTLLQRAKPSNFLLDRKKTDKLKKKKKRKRRDSDAPGKEGYRGGLL     71 - 140
KLEAADPYVETPTSPTLQDIPQAPSDPCSGWDSDTPSSGSCATVSPDQVKEIKTEGKRTIVRQGKQVVFR    141 - 210
DEDSTGNDEDIMVDSDDDSWDLVTCFCMKPFAGRPMIECNECHTWIHLSCAKIRKSNVPEVFVCQKCRDS    211 - 280
KFDIRRSNRSRTGSRKLFLD                                                      281 - 300
//

Text Mined References (10)

PMID Year Title